SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11195T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11195T0
Domain Number 1 Region: 73-285
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.47e-52
Family Ankyrin repeat 0.00013
Further Details:      
 
Weak hits

Sequence:  PTSG_11195T0
Domain Number - Region: 362-492
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000279
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.08
Further Details:      
 
Domain Number - Region: 499-553
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00345
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11195T0
Sequence length 680
Comment | PTSG_11195 | Salpingoeca rosetta hypothetical protein (681 aa)
Sequence
MPRPPDVLKAARANDWRRLLDIVTGKKESRLRSTIRRKRKPAGDGASNATTLVLDKNDDG
SLQVKPCAPGVRIDLRDDTGSTPLILAALGGNVEAASCLIAYGANVDAQDTDGNTALHMA
AWQEREHSVDVMELLLKNGADPNIANAENRTPLHNAVQNGQTFAVMVLLDHNADVHVRND
AGETPLDIAVRFGREEVVSVLLNHDISVTKSTRALREAAQMGRASLVRTLLDMGMDVAAE
DPETRDTALHVAVKFSRTSAVETLLAFGADPYQPNAAGKSAHDAMLDLSDERTRDVMLAL
VEEYKDKDVQLPAIVLNERRQRKAKQAIGDYQSTKQATSSEAHDPVIRVLARWCEDTAQW
RSTAHPDWPVTHLLSEDPSAEWRAASIGPQWTAFKFPNLYTITGIDLVARPGPHVPRDVQ
LQVADGLEGPWRAVASFKMQSQPGPGVQLDMVTHTMTQHFSGFHATSQYWRLNILRAHGS
VACALSHVRFYGFDAVMPKWFAEHGMTEYLQPFIDAGLNQLKELTMADRDKYAKIIQLPG
HLKKFELAVLDLKGEKRGFDRLVFSRPPPATAVAGQALPMFEVQANAGADQEVELVVHGN
AHVTGTMRARLLPNGSHPSIAFFDDIVLAPPGQYMLEVRSVTDPTRVYVKSPHPITVEAP
PRKRSAMEVLFADYSPMLAF
Download sequence
Identical sequences F2USP6
PTSG_11195T0 XP_004987840.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]