SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11196T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11196T0
Domain Number 1 Region: 170-366
Classification Level Classification E-value
Superfamily vWA-like 1.31e-52
Family Integrin A (or I) domain 0.00068
Further Details:      
 
Domain Number 2 Region: 1030-1133
Classification Level Classification E-value
Superfamily L domain-like 0.000000000681
Family L domain 0.012
Further Details:      
 
Domain Number 3 Region: 1328-1405
Classification Level Classification E-value
Superfamily L domain-like 0.000000188
Family L domain 0.033
Further Details:      
 
Domain Number 4 Region: 1217-1298
Classification Level Classification E-value
Superfamily L domain-like 0.000000476
Family L domain 0.017
Further Details:      
 
Domain Number 5 Region: 24-172
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.00000188
Family Hedgehog (development protein), N-terminal signaling domain 0.0073
Further Details:      
 
Domain Number 6 Region: 923-996
Classification Level Classification E-value
Superfamily L domain-like 0.00000374
Family L domain 0.03
Further Details:      
 
Weak hits

Sequence:  PTSG_11196T0
Domain Number - Region: 506-545
Classification Level Classification E-value
Superfamily Cadherin-like 0.0275
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11196T0
Sequence length 1440
Comment | PTSG_11196 | Salpingoeca rosetta predicted protein (1441 aa)
Sequence
MQIATLARVAILLAVATATTSTYALLPGEWYPDGSTEAQVSGTAVDYIDLGTAQYNALID
FEEFYLNSTGTSSPVTFASSTFRLMTEYLAEKLTALALDTPDTIVIVQGFAPRPTNPTRP
PELTDIGRGLHMRYLNNGSLTNFLSDLANRSIEAGFDFVAIPGQGSYVNVSVPNVNCGRS
AVDLLFILDGSGSIGSSNFETMRQFTATVTSFFDVSPDTTRVALMVYSSSVTEIFDFSYV
LSNTRDEIITTIRNTNYPGGGTRTGSALDYARTNMFLTSRGARPSSAGVPRVAIVIIDGQ
SGDSVAQPAENLRNENVNIFAIGISGADVNELNMIASPPITNNVKFIDTFQAFSQLPAEI
SRANCEQPAVVSATDEIQINDTQPGEIRFFRPNPVNLFDNETDVFVSVTSPNPGPFNFDY
VIMNDEPLKTLNVRKTSSQVVSIAVRSRLTLLGRRRAEDTISYRLRVFNDLFNGPASHTI
MVTPARNQRGAPIFDAPEAINFPGYSFTYTLTGPGSSMFDIDASTGRITLRDPLPDGTQH
VVTLTGTSGSIVGGLALMVTTGQPTAEAATAPFTDVSATAHGDLHILTTSDARVWAPCST
AADMGAPAVAPFPTLFVGEVDLLHALRNMSNVARSINTWAMQEETRLFPAADEDTLLQLQ
DASKAATTWAAASLMPACTPRSNDAATLPDHAGWLETADDGTLHVVTQGSLRLHIPRTGT
LRVGDFDVVAALVNASNTLDRLRFGITDTLPSSFTESFPAEATAIGLPLSNTHDGTDPPA
FASTDSLPFTGIAVDDNSGELHMYSERDVCFLHTAHDGSAETDAGDGGAPRVLVGGVDIA
VAVMNVTALINTIATPLQALLDEAKLTLDCSDPASRNPIPTSGVSQVGSVVNCCCPELTS
LRRVLGDVHIATAATSADVGALQDVLGSIVLSGGQLASMDFGALRTIGGHVRITGAPLTS
INLGSIVSIGGDLDLRDNTALTSVSFGDITSIGGTVLLPRDTPGIGTVDFSHVRVIHGDV
DLTRTDTTQVLFGSLTHVGGTITIAYNAITNVDFSDVSHVGGDVVLIGDNSLESVFFNAL
TRVDGSLIVQGCTALSQINTWELHHIGGDLRLSNNVMLLSVSTAALRTIGGDYDVRHTAV
SAVTLTQLTRLGGMLWVDHDLFTTINHAELAAAGGGLGVCCGGPNVDTLNLFPFLFPYGI
GVDSMAGLRSLSIDSRTVVNGSLVITNNAALTAVSFHNAITAINGHVEITSNPMLASLQL
TSVAHIRGDVTVTRNAIMSTIAFPLLTAHNHSLILEYNDLAAVDIGELTYLGGSLSLYRN
NLGSFALTDLQYIGGDLSMAYSTLTTVSFGALTSVGGYLHVGYNPLQRLNFANITRIGGY
VAAQGAALSAVDFGALTSVGGILNFRANVGLTSVDCHSVTAECIAFSTAASLFNCPKPCD
Download sequence
Identical sequences PTSG_11196T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]