SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11235T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11235T0
Domain Number 1 Region: 7788-8091
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.93e-86
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000544
Further Details:      
 
Domain Number 2 Region: 6387-6511
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-31
Family Cadherin 0.00054
Further Details:      
 
Domain Number 3 Region: 4731-4853
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-31
Family Cadherin 0.00067
Further Details:      
 
Domain Number 4 Region: 3617-3754
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-27
Family Cadherin 0.00085
Further Details:      
 
Domain Number 5 Region: 1680-1798
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-26
Family Cadherin 0.00067
Further Details:      
 
Domain Number 6 Region: 1313-1439
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.0006
Further Details:      
 
Domain Number 7 Region: 2715-2821
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-26
Family Cadherin 0.00032
Further Details:      
 
Domain Number 8 Region: 2604-2729
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 5170-5287
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-25
Family Cadherin 0.00047
Further Details:      
 
Domain Number 10 Region: 4158-4277
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.00071
Further Details:      
 
Domain Number 11 Region: 3395-3512
Classification Level Classification E-value
Superfamily Cadherin-like 1.18e-24
Family Cadherin 0.0017
Further Details:      
 
Domain Number 12 Region: 3291-3406
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-24
Family Cadherin 0.00037
Further Details:      
 
Domain Number 13 Region: 655-781
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-24
Family Cadherin 0.00089
Further Details:      
 
Domain Number 14 Region: 2273-2398
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.00084
Further Details:      
 
Domain Number 15 Region: 4059-4170
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.00092
Further Details:      
 
Domain Number 16 Region: 3961-4065
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.00094
Further Details:      
 
Domain Number 17 Region: 5647-5759
Classification Level Classification E-value
Superfamily Cadherin-like 3e-23
Family Cadherin 0.0016
Further Details:      
 
Domain Number 18 Region: 4374-4504
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-23
Family Cadherin 0.00049
Further Details:      
 
Domain Number 19 Region: 2384-2508
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 20 Region: 5394-5498
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-22
Family Cadherin 0.00062
Further Details:      
 
Domain Number 21 Region: 5072-5182
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 22 Region: 6831-6960
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.00087
Further Details:      
 
Domain Number 23 Region: 4265-4393
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 24 Region: 2823-2937
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.00058
Further Details:      
 
Domain Number 25 Region: 3039-3162
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.00078
Further Details:      
 
Domain Number 26 Region: 6281-6400
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 27 Region: 2925-3037
Classification Level Classification E-value
Superfamily Cadherin-like 4e-21
Family Cadherin 0.00056
Further Details:      
 
Domain Number 28 Region: 6707-6847
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 29 Region: 3851-3958
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 30 Region: 6611-6711
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-21
Family Cadherin 0.00085
Further Details:      
 
Domain Number 31 Region: 771-880
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-21
Family Cadherin 0.00056
Further Details:      
 
Domain Number 32 Region: 3735-3858
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.00098
Further Details:      
 
Domain Number 33 Region: 2501-2608
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-20
Family Cadherin 0.00074
Further Details:      
 
Domain Number 34 Region: 4629-4735
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-20
Family Cadherin 0.00067
Further Details:      
 
Domain Number 35 Region: 1924-2054
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 36 Region: 5871-5960
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-19
Family Cadherin 0.0017
Further Details:      
 
Domain Number 37 Region: 6947-7070
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 38 Region: 5499-5549,5592-5645
Classification Level Classification E-value
Superfamily Cadherin-like 7.12e-19
Family Cadherin 0.00099
Further Details:      
 
Domain Number 39 Region: 988-1100
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-17
Family Cadherin 0.0025
Further Details:      
 
Domain Number 40 Region: 5288-5392
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000124
Family Cadherin 0.0014
Further Details:      
 
Domain Number 41 Region: 4966-5078
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000286
Family Cadherin 0.0017
Further Details:      
 
Domain Number 42 Region: 1207-1317
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.001
Further Details:      
 
Domain Number 43 Region: 1784-1835,1872-1937
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.0028
Further Details:      
 
Domain Number 44 Region: 3153-3263
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000514
Family Cadherin 0.0013
Further Details:      
 
Domain Number 45 Region: 3503-3621
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0019
Further Details:      
 
Domain Number 46 Region: 7294-7442
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000319
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 47 Region: 4841-4965
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000614
Family Cadherin 0.0015
Further Details:      
 
Domain Number 48 Region: 881-987
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000814
Family Cadherin 0.001
Further Details:      
 
Domain Number 49 Region: 2046-2138
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000131
Family Cadherin 0.0019
Further Details:      
 
Domain Number 50 Region: 566-667
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000243
Family Cadherin 0.0014
Further Details:      
 
Domain Number 51 Region: 1102-1214
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000785
Family Cadherin 0.0031
Further Details:      
 
Domain Number 52 Region: 6498-6618
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000814
Family Cadherin 0.0025
Further Details:      
 
Domain Number 53 Region: 2158-2288
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000128
Family Cadherin 0.0028
Further Details:      
 
Domain Number 54 Region: 1573-1685
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000728
Family Cadherin 0.0094
Further Details:      
 
Domain Number 55 Region: 5753-5869
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000286
Family Cadherin 0.0044
Further Details:      
 
Domain Number 56 Region: 4487-4635
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.0025
Further Details:      
 
Domain Number 57 Region: 1419-1557
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000331
Family Cadherin 0.0069
Further Details:      
 
Domain Number 58 Region: 114-294
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000345
Family Quinoprotein alcohol dehydrogenase-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_11235T0
Sequence length 8158
Comment | PTSG_11235 | Salpingoeca rosetta protein tyrosine phosphatase (8159 aa)
Sequence
MRTAVGRFARLLLGATLVCTLLATAACNAQDDPIAISLREGESTDVDVFVDGLDQVYLTG
TSQTATWSTRAQASNFAVVPLRSVNTARSPASVVCSWPEPGTQLHIVSEQGVGTGSVNVY
DATTLELVQTLVVSDKPAGLCRARVGGVEHLAIANTRTGNDFATKSNVYAWDTTTQQFVL
LQRVSTVGASACAFAQRGDATTLIFSNSQDNSGNTNLASPVLRFNATLGAYVQVQELATQ
GATDVTAVHVPANSAVDDQDHVLVVLANKYDSQQASFDTPSSVWRMQADGTFAPMLTLAT
SGAESVSAVCQPSSSIAGDCDLTVALVADQGSTVAIFRLLNAHTAITAAATTATAAPMHV
GHTQSIALDTENKVAVHALLFTVGSPMAQQQQQQQQQQQQQPLGLFVSVERLAAIEYQFD
ADVNAFVDVSEVSAITHAVAAVQCSPQQLAVVTAGSVSLSSDGTLEDVALTPIAETSTDL
YFGDRGDILPAVATATAAVLEVHLTPSSSSSSSSFAVSITAVADAVVEGDETATLQLLDA
NATVLRTWSLTVLDNTKDMLLDMRVNATVEENASAGTLVLPASNVRLDTSGVSGGNAAVA
FTIQGVSSALFSVNADTGAISTATPLDRETQSTYVATLIATDTATGQTDRMQVVISVLDV
NDNTPQFESSMYIVEVDEGQPVGAHVLTVQAVDDDANSNGVIDYSIVGDAAALQTFAIDA
STGAITAMRTFDAEDTASQQLFNFDVFARDRAGANSRTSSTKVFVVVRDTNDNAPVFREG
TALSLAVAEDVAVPTLLTTVSAADADNTSPSNLVQYSLVSADSTPSADAAFDVDATTGAV
TVTSPLDREATAAYTLIVLASDLGTPAQTASLNITVTVGDVDDNAAVAAMDRVALTVSEA
DAPGTVLTTIATTDADTTTTAPRFYLANGDATTTAESLLAVDRATGVVSLVQSIDREAVT
SLQVTIVVEDPFHGVNTTTLLTITIADVNDVVPTVTAPRAAVNVSEDTPVGTLVTRVVAV
DTDTPPNANLSFALLSDFSDSDAFAVDARTGEVTLVAPLNYEAKQTHSLRVQVRDRPAST
STSTNDVNTVQHTVTIAVVDVNDEPPRVLQSSLAATVQEELPASTVVVASLGFSDADTTP
AFSTLTYTVSEPTMFAVVQDGDTGDASLVLARPLDRETDGDAVTVTVTASDGLAAADVTV
AVTIADINDNAPVFTGPPPARLDVAEHTAVGTVVQELVATDADQANTPASAVRYNITGGA
FARFFTLSPTTGALAVAADIDREALAAQAITGDVVVTAYNPGSDLASTHTMQVTIADIND
NTPVFEFAQYNATIAEGEQGVVVATVTATDADAGDNARVQYELDVASRALFAIDAATGVI
TTRTSSIDLETDAQATYMLSVTARDGGASSRSSTAHVRVFVTDANDVAPRFEQSTYTVTI
SDVQEGPVALARVSVVDGDVSLVNRITSVAITAPSPPSPSSTVESALAGAFAVNTTTTAT
ENVFDVVFVGPLPEAVRGAMTVRLSLVAANTAAPELTGSAVLDVVVVATNKFVPVFVSGD
DGPAEAGPISATTQHVLEDAALGSVVGTVYAVDGDVGSEGEIAFAFATGNDAGAFALTPA
RVVVVAVPGIAEPVTVYASNITVAPRGPGLDHEAVAVHNLMVTATDQGVRQATATLNVTV
EVGDVDDNAPRFQQGVYAHTVAEDAVVGTVLVTVAASDPDTGINDPLTYDLYITGSHNPF
AINATTGEVTLAAPLDFEQTPSYSFRVLAFSGNSPLISSARVDVTVTDVNDNTPVITNMP
PGARLEVSEGVVPVQQLYNFAATDADSGDNAALTFTLVSVAAKPRTNTAASNSSVSMGGD
GGETWTMLAPDGSGANPFFLEPASGVLVVQSAVDSETYAEYRLLVRVSDAGSPSPRSVDF
NITVAILDENDNAPVFVDADGSATDGAVGYVFNVSENTSAPAAAGRVYAPDADAGDNGAV
AFAIDNTAALLPFVIDAQTGVISVSSALDREDVGAYTFVVVATDQASNADDRQVATTTVV
VNVLDVNDNDPVFDTAAPPARVSVNENGNTPRTVTAFIARDADEATTLAFAIVSVQPAEL
ASSLSLNAATGELTLLAPLDYETHTEVTVVVSVSDGGASGTGVDAAAARMAQRRLVLDVV
DENDNAPVVTVDGGNAVADGTELSFTVQEEAGVRTALTAVNVTDADSAPNAQPTLRIDTA
YAQASMFSIVDGVLYIASTDREQREVYAARVVASDVGTTPQQLSTSFTVRVVSTDINDNA
PRFAQPAYGPINLVENRPAGEHVVTVQATDIDAGDNAVVVYTLADTFDGRFAINGTSGAI
TTTASLDREAAPNGYVLAVVAANLNDATGPSSAVNVTVHITDINDNPPVFEQQSYAFTVA
EADGSTAGVTGAANNNDNAVQFVGTVRATSADIGDNARIVYALAGGDTDVLRINATTGAM
YTRRALDRETQDTYQVQVTAADVSATPLVTSVTVTLHVLDINDNAPVYAHGDFTSVIVLE
DAAPGTPIGVQVAARDADLGGNGTVAYAIVAGNTNSDFAVDPTTGVVSVARRLDFESVVS
YTLTMRASDQGTPQPKTADVLVVVSLVDANDEAPVFNADVGAQVVAENLPAGKVAAAPFA
TDADITAGFNRVSYSIVGGNAAGLFAIDAATGVVRTTGPLDRETDAAYNLTVQAADNGEP
PLTATVAVPVVVGDVNDNAPVFTSNAYYAWSVSEDAAPNTLLGTVAASDADAGANARVTY
SLINATAPLFSVDATTGEVRLTGGQLDRETAETHTLVVRARDSGAPVQLSTDATIVLTVL
DVNDNAPVFVDLPMQVSVFENATTADVVLRVSSTDEDVGTNAQVEYTLRAANEVSAPEPL
AFTIGRFTGEVTPVGALDFEMHQTHTLVVVASNPDGRETTAVVTVNVVDINDNNPVFVDT
DVQATLVENADVGTAVASVMATDADSAANTHVSYVLADSEVNGVSVSSVFAINASTGVIT
TLTALDYEQDVRTYVLEVTASDGHMPAPRMTLLPARVTVTLTDANDNAPVFDNLPISGTF
TAAVSEAATTATSVLSVEVSDADSGNNARVALALAGTDASVFAVSPAGVITTTAPLDRES
KAAYSFEVVATDNVDGAMQNTVTATVLVTVLDVNDNAPMLTAASQAATSFRIAESAAVGS
EVFTYVATDADEYHASDSTTSTSTNTNTNTNTNGAVRYAIVGGNLDGAFAINATSGRLSV
AKPLDYETFVTYTLTLEVADATTLALAEGTPASPSFPPPQPTNRVALTVRITVDDVNDNA
PAFSQTAYAASVLENAAVDTAVVRVAAQDADEDGTQAVRFSLATHASEFAIDAETGQITT
RVVLDREAVPVYSVVVTATDSAVRNPLSTNVTVTVAVDDKNDNNPLLIGAPSALTISEDT
LVGARIAVLNATDADVGPNGDVTFAFVGAQRFLAVDAHTGVITLATAFDRETQAEHTFTV
RAQDAGQPPRSDVATFTVTVGDVNDNSPAFVTQDGARFTVSELAGTGTRVGGVTATDADA
GENAAIAYSIVAGNDAGFFAIDTESGEVTIGGVLPAGAFTGRPSADRSVTLTIEASNPAS
APAPSGAVPSSTLDIVIVVEDENDNAPVFVGLDSAYAVVENSAVGTLVFTAQVTDADEGT
NADVTYALVAVSGADSTADTSGVFAIDSASGEVRVRGAVDREAQALFTLVVRATDGGSPA
LFTDATVTVAVTDENDSSPSFVPSSLTATVPETSAAAAAAAGGDGGAMSGDVVVLQLRVT
DADENDSATFSITGSSTGTAEAFVLNATTGVLGLARWLDREQHAVHRLTVRAVDAGGNVA
TATAVVTVSDVNDNAPRFASGVERRMVAENVAGVTTVGVFTATDADEGSNAAVTYSLVST
THPGGNSAVRVDADTGVVQLTQALNFEETTQINVTVEARDGGSPATLAAQLVVVVTVQNT
NDNDPVFDADTIEVSVREGEPIGTRVHRIVARDADGDTVAYRILTSGTTFTIDPTTGWLS
TNAVLDREEEDAYALTVSASDPGGRRAVATVLVRVVDVNDNAPVFERERYEATIIENFNF
GSTVLTARASDRDLGANGTAGIVYSIRDGAGSSNFAIDSATGDVRPTTALDREVLPVITL
TIVAEDGGGLQGTTTAVITLFDQNDNQPEFANATYTLTVAEGMPAWTRVGAVVAQDRDSD
ANAIIAYSLSGSGDEALFWVNGSTGEIFATAEFDRETKDAYTFTITARDPDATRFLFTDS
ASVTVLIDDVNDNTPQVQAEYSADVREDAALGTLLVTVAATDGDIDDNARITYTIATASG
SLQVPFAVDAVSGEVTVAGALDREQQELYVFDVVATDNAASVDQRRSARTTISIALLDVN
DNAPVFSHGEFVVFNVSEAAAGGDVVGRVIATDADAEENSVVTYAAVAGDGNSLDLFACG
SDGVIRLAAGATLDREEQNEYVLLVAASDIGGLNDTQAVVLLVTDVNDNAPTFDAPAYSI
AVTEEEEYAATSAGGEVVLLQVTVNDADLGTNAAVTFSVEGVGAEHFTFEVVDVSPDRSD
STTTTARLSISTALDRETLGSNFTLTLVATDSSSDGGSGGSNDVTLPSTPSFPALRGTAR
LHVMLADINDNAPSFTAPEPFVAHVREDAQAGALVTTIVTHDPDEGLNGVVRLFQTTATS
VFFVNTFTGEVRLLVSDLDRETTDTYEVTVVAEDRAADPDARQATTATLVVHVTDVNDHA
PVFEKSVYTQDVREDIAADTPVVVVAASDDDAGLNAQLTYTLDEDEGGLFVIDGSSGEVF
ASRPLDRETRESYVLVVRATDNGSEQRLSATARVELTLLDVNDHAPIFTNTPSQQQGPIR
ATLPEDAVSGVHVVTLTATDGDATAPNNDVRFGLAANETWSHAFEVDAVTGAVRVATGDA
GGDVQWFDHETAAEVAVTVLVYDMAADVADRLTTTAQLVVAITDVNDNVPQFTPREYVVT
VVETQSTTEPIVALVVEDADQGVNAQVEFEIAGGNMNSAVRIDASGTLYPNNLDFETAPI
LNIIVLASNPAGALGAQPSAVATVLITLTDDNDEHPAFVGAPYAFEVSEGAEVDTRIGSV
LAQDPDTGAGGQVEYLLVGGNAAGKFKLEGGTLFTAGRLDREVVDTYALVVRARDLGTEQ
QLFTDVTITVTVTDENDNAPVFDEEAYTASVLESAALGAQVVRVRATDADLADNARITYT
LLGAGTTNSTGSAVVGAFEIDASSGVISVARPLDRETQAAYELTVVAVDGGVEELTRLVG
VTITIGDVNDNPPYVTNAVRTASVSEALAPESLILTVTADDVDIVDTDVVFWLQDSSDDL
FAIDRDSGRVTLQGALDYESARSHTFVVRVANAATTSLDQFTEASFTVNVQDSNDNAPEF
AAELPSELDVPENVLAGSTLIVVTATDADEGRNSDVTYALRSTHNDTFALDALSGRLRVL
KPLDRETRDRYALTIVATDRGVEQQLQTTFDMLVRVQDVNDNAPQFDQVLYEGHVSEDAS
TGTVVLQVVARERDIGATVTYSIVAVLASNDNGNASTTQPASTTTSSATTKTTTTTITTT
TATTSTTSTTMVPTVLPFEIDAVTGEIKVSIALDRETVQAYRFVVVATDEDGLNSTASVH
VIVDDVNDNAPAFVQGGYSATVAENTAGVDLITLAATDADRPATPTQLTFSLAQGEWSQH
FVVDPVSGVVQLVQALDREAVAVVYLQAVVSDGGLPSARTSTVAVVVTVTDENDNAPVLD
VASNPTVVQLREGAANGTVVGRIAATDADETSTLAFAILNVQTEHAGNENTAAAANAEEP
TFVTMDAMSGMVALARDLDYEEASAVVVQAVATDGAFTSGTYVIRIEVENINDSPPVFAQ
PSVQASLPENNAPGAVIARLAASDPDGADLGALRYFISYSSHPGLVAVNATTGVVIATQT
IDREETGEIVVRVTADDGGSDGGNRRRRDVLNSTSTTTATATATTIVAGNDTVQQPTTTA
TTTAATTASATATTATATAATTTTTTTTTTTTTTTPVANDVCSRFVTASECEAVAACVFA
GASSVCFNASEPAPCELLFESNCTAYGCETDPALSNRCRHIGQRLPCREYPTNDTCPDDC
VFMATPLAGGLCLEQGEPVPCFAFDVNTCPSDRCALQGGACAVKADTTATTTIAPGSTPV
VGTTTTTTTATAIATATTTSNNNISTADSSTRMMVNGTAASSTTPTTTPVVATTATTAST
VATPSTTGVTTPVQTTTAATTTASDAGVACAGLCTTVTLTITVEDINDNAPVIVTRDVLL
EVREDVAVGSNITHVVAVDEDDGANAELFFRFTAAQSVFAIEPSTGAITLAAPLDFETTT
LYQLTVEVDNTNTYDDPTQMDATTVTITVLDTNDNAPVFTEGGSYAMSVAENEGVGAVVG
RVQVTDADSGVNELVSFMLVGGRADLFSVNPVSGVVTTLQPLDREVQAEYALTVLALDQG
SPQLSTNATVTVTVGNVNDNAPQFDQAVYRVEVDERRGTTGAVVPLRAVRLTATDGDGDA
MVFSLAPTPFAQYVQVFTNGDVFVTPSFDHEQLTQFNVTVEVTDVVAGGAGSGAGAPMTT
TAVVVVDIQDINDRDPVFLADTYVATVSEAASVGTPVVRVSASDADASNVAIRYALDDGG
LSPFDIDEASGLVVVAGSLDRESAGSYQVTVSARDDGDRTGFASVVITIADVNDNAPLLP
PSPLDVSVRENADAGTLVTTIVATDSDAGANGQVSYFLDYARSTLTRAGTGATQAGSEAT
IPFTIGETSGRLAVSGNVDREAVTAYTLVVFAVDGATGTDQARSQDLVVRVAVGDENDNA
PMFAASTTAGASFDATRATYQVSVQEDVSVGSEVLLLAATDADEGANAALTFALVSSGGA
GVSVSSSGAITLTSPLDRETTAQYELVVEVLDGGSQPLGARATVQLTVLDVNDVTPAFVP
ASIADLVLSEDQAPGMVVRTLAAVDNDEGNNGDLVFALITGVDTLSAVSGPFSIDASTGD
VYVSALDYEQMSAMQLRVYVTDKGQPSRSATASIAVSIVDVNDNAPVVSAVQARATLEVS
EAIPVTGAGLFGVAVTDADGTLLNSDISISLQTTLLTGGGDAGDGGDDDAVTTTTTTTTT
TSGNVKLTLDSGSVGIVAQGREAIVIAEDLQYDATSTSTYTVTVSASNPRAAASDVVTTQ
VNVHVLPFLDQTTPADASAVVFNMAVPDPCLDYPDADYCRNLGRSASNRLRYEVWTRRNF
NCEPALCNDQEVVVATASSSATACMCRVFGKGDAGYSAGVSTYTLDGLLPDTTYEFQLRA
YDSSDAKVGTSAFYPLRTTQFAPTGVALVRQNDGLYNVSWQAPRQPNGALVGYRACYCDA
SIAPATCACGIAGAVQVPQGITTRTWVLAPDDGSVLPANEEYTFVVEAVTTLSDGTPTQE
RSNTVSTTLAVNEDDVNSGGGGSGSGGNTSASGSANALGSGVIAGIALAGVLLVLLVIVI
VVQLQRQNQRSGMTDLARLYGNGGDGGSTGGGKRPPSMFVDNGNLFELPVVGEEGVMLNS
SSNNSGGAGHPSGLLMESTFQGHSGAPGNGMSRVMLVGGSAGGAMNESEDHGFWDYYVKE
RADQFLAGAHGHNASASGMQGGNASNTTMAPWPQQGQEPSMLHHKPLVLDGDDGGGLNTT
STNTDAMVADASQQQQPDAYGSSSSNSSDNAATNEYSSSARASRGSFGLRAPRVLGNGLG
GIQVATRAMRSDSIAGVVTGKQVMEAAEQDGVRAQAGVRFRGTQASGTRIDARDVEVRFH
EMRQKGAVDVEFERLQQESAHHTFAMEVGTQTYNVRKNRYGNVIPLDDTRVLLKATGQLG
SDYINANYMPSMKRAPAFVVSQAPVPATIADFWRMVWEQRAGVVVMVTREVEKGKIKCHK
YWPDAPANGSPGGTDNEHGGDGVIYAGRFEVRHVQRQVDADGGYELRTFSVRDPEAGETR
EIRHFAVTSWPDHDVPESAAAIIKCVLDVRRAVETQRTAGLHGPAVVHCSAGVGRSGVFV
ALHNCMQQLEMQGAVDVYATVLYMRTFRAGSVQTLSQYRFIYDAVLAYFRSNAPQLLQVG
TTAHGGGGVGVDGGGAGVDGGGLHNVSASMARGQPVTRAPTDDVAADPEYLIHALAQI
Download sequence
Identical sequences F2USU1
XP_004987734.1.12839 PTSG_11235T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]