SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11245T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11245T0
Domain Number 1 Region: 34-325
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.33e-76
Family Amylase, catalytic domain 0.000000165
Further Details:      
 
Domain Number 2 Region: 410-461
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000317
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 
Weak hits

Sequence:  PTSG_11245T0
Domain Number - Region: 318-361
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000719
Family alpha-Amylases, C-terminal beta-sheet domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_11245T0
Sequence length 463
Comment | PTSG_11245 | Salpingoeca rosetta alpha-N-acetylgalactosaminidase (464 aa)
Sequence
MGTRTVAVQAVAMLVCAAAVFGSVTGASDVGCRNKLAQTPPMGWMSWEIFRCQMDCKTYP
NSCINADLYKTTADAMKAKGFLDAGYDTVHIDDCWEADARDPNTGRLAANADRFPGGIAP
LADYIHKLGLKFGLYTAESKTTCTGHVGSYLNEILDAQTFADWGVDYLKVDGCNPNKTYY
PTGYTAMGTALQISGRDIVYSCSWPAYLGSNETTKPYNTMIGIGCNLWRNWHDIQCNWKS
LSSIIDHWGDYGQVLASYAGPGHWNDPDMLLIGNDCITDDQARTQMAIWSIVAAPLIMGN
DVRNITASTRAILLNRDAIAVNQDPLGQAGFRISPKGATEVWARNITNAVAVALLNKGSQ
SSSSADSEASRAQTMRLDLPAGNDGQGPVFTHVDRDAQLRARSAAATAANTTTITVNFSD
IGVSGSADVYDIWAGKTVGTFSKSYSALVPEGGTAFLRITPKK
Download sequence
Identical sequences F2USV1
PTSG_11245T0 XP_004987744.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]