SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11259T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11259T0
Domain Number 1 Region: 346-479,508-657
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000000491
Family YicI catalytic domain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 668-740
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000108
Family Putative glucosidase YicI, domain 3 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11259T0
Sequence length 947
Comment | PTSG_11259 | Salpingoeca rosetta predicted protein (948 aa)
Sequence
MMCGSGGGVCVSTAATLVLLVVGALIAVNTLAAVSAAAGGVPLKRPPSSSSSSIIIVGDV
RVQALAENLVRVEPRGPQGFEDRTTFAVVDRTAFDPGVPIHKVNASGNVTFLATSAYLLR
LEQHPVPPPSPPPPMCENPRQGYDITNGARVPEYPGGIDNTTMTQCCSKCQALKDCTAWI
WDTADTHTCWLMATISGPIHPAQNRIFGGYIPPPPQAGVAVTVYTADGASVLWSSADVGN
VSANLAWPSPMSADAFAFQDRPRFYVPPWGPTPHSGSNFGVGGHRPDGHGQSLSKNDTNG
YDFRNNVVGDTYIFLMPRQQAHSSTSSTSSNTLPAGMDAWHAGRRTLLALTGPTPLLPDF
AFGTWFTYWHAYTQSEAEGEVARWIEDKLPLDVWGLDMNWRNTTDNQDHYYNHPNTTLFP
NFTAWFDFLHARNVRTYFNDHPYPQGPQTSAKEVAFRWHGLTEWMARGLTYWWFDSNWGF
SIPPPHVNATTTGAEWQGLDNRAWGAHVYYSIVKTYNAKHRPASFPRPITLNKFAGGDQR
PGMTQHEHVAHHRYPVWWTGDGVCLQASIESMVDTGVYDLKPYVHSDCGGDYRGSAGDLM
RWIAHCSLGTVLRLHGAEHQPWSYDNHTEDTIRNYLDLRYRLIPTFISAGVTATATGFPL
VVRGDVFWPEHAPDAASNHQYIHLNETLVAPIFDTSANMTQRAVWVPPGAWQDAWTGKVV
TGPAWMNVTMPYEQLPMWHRKGGMLVTATHPGTRAALQDWSSLTLEAFPMFGDGGVDCGG
NGVEKVVYAQERYSSNRDDGGGGGGGGGGDACVRVRMTTSAMNATHRDDGDNSWRVRVFI
APDHRCGGAVTSEWVVRLHLDAGMTATSAVISRNGGDVGDDGDDVNGATLPISLLLPGKP
GDDASRHHFPLRGRGSAPAPHAGPIAEVVVVTTATATTTLDVVVTRT
Download sequence
Identical sequences F2USW3
PTSG_11259T0 XP_004987756.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]