SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11280T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11280T0
Domain Number 1 Region: 34-271
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.21e-18
Family NagZ-like 0.016
Further Details:      
 
Weak hits

Sequence:  PTSG_11280T0
Domain Number - Region: 538-580
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00377
Family TNF receptor-like 0.0084
Further Details:      
 
Domain Number - Region: 437-486
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00447
Family TNF receptor-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11280T0
Sequence length 708
Comment | PTSG_11280 | Salpingoeca rosetta predicted protein (709 aa)
Sequence
MCGAANRMNIIRANCYGTPVPTGHACLSAATKELPFCNTSLSIGARLDDLIGRLSLQEMA
GLIGPDPVTSPCAFLDYGVKRLDIPPYLHLVETNTAVVSACIISQDKCATTFIAPTGLGA
TVVSTEMRAFNDLNWHRGGGVLQKIVLTDPCLSGECAAADVTGCQDGTDKKYKKMTAGFK
HFDAHSVETNRMAFNGNMSTFDFWDTETAVRFAHMVNANKHACDPVDAVAKTLNGGADME
LWGTYCTKNSHLGQAVQQNRTTVHTVHNALRQASMSARPADPSLTSNNGRCISEYPDGEY
ELAHAPHLLTPSALPGPSASLAGRSLSVSGNAVRDRVCVSCTLGMEYQPLPERASCFPTS
VCEEPFIETIPPTLTTDRLCSCDTLTCNKLVTQLFEEMVCAKPTDEQLDVVLDVCCSNQG
EDCIRDTIRQMDAYEARHSCPGCTDTCECSAGFILRTRAPTSTSNTKCEPCPIGTTDHDR
NPLTACQPCLYGHYVPAGSIGSCKQFLCPAGTADLDRRNASTRRVRRARLAWTLPPSLAQ
RDCTPVTECDLGYEEMVRPTIFTDRQCRRCIEALFYRDSNTDFSTRASARRGRSACLTEY
ELVAPSLVNDRECQRVRTRARTRSMRFILRIDLRQGTIIATVASINEDFTARLFNRSVSG
DITVMAFTASPCEADAFLDDSSLWLHGTASSSSGCGGRGARHGYSSDS
Download sequence
Identical sequences PTSG_11280T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]