SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11285T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_11285T0
Domain Number - Region: 147-169
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00286
Family TNF receptor-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11285T0
Sequence length 187
Comment | PTSG_11285 | Salpingoeca rosetta predicted protein (188 aa)
Sequence
MEYQPLPDRASCFPTSVCEEPLIETIPPTLTTDRLCSCDTLTCNNLITQLFEEMVCAEPT
DESFDVVLDVCCSGQGEDGIRNTIRQMDAYEAGRSCPGCTDTCECSAGFILVYDADSAGC
RPCNGVTEFSPSIGGSKLRARVEEVQAMTLISDRVCDECPEGTYKAVWPGRALSPRHHVR
RRRGGDS
Download sequence
Identical sequences PTSG_11285T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]