SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11356T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_11356T0
Domain Number - Region: 552-597
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000149
Family TNF receptor-like 0.0048
Further Details:      
 
Domain Number - Region: 855-891
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00416
Family TNF receptor-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11356T0
Sequence length 979
Comment | PTSG_11356 | Salpingoeca rosetta predicted protein (980 aa)
Sequence
MAQTSMTREACATLCYTFKNPSSDCNEPCTGTSTEMCGAANRMNIIQANCSGKPVPTATK
ELPFCNSSLSICARLDDLIGRLSLHEKAGPIGPNPVTSPCAFLDYGVKRLDIPPYLHLVE
MNTAVASACIISQDKCATTFIGPTGLGAAVISTEMRAFNNLNWHRGGGVLQMIGLAGLRH
VDAHLVETSRMAFNGNISTFDLWDTEYKHGHSLPSAKTLNGGVDMELRETCFTTNSYLEQ
AVQQNRTTIDTVHNTVRWVLKDSFIMGQCYRSANLSLTSSIGHCISECPDGEYELGQRSC
IAHCPLDYYAKDHRCVPCTTCGMGTWASTPRSASSDAVCCSWTERKPGQKESVSGNAYQP
LPERASCFPTSVCEEPFIETIPPTLTTDRLCSCDTLTCNKLITQLFEEMVCAGPMDEQLD
VVLDVCCAGQGEDGIHNTIRQMDADEARRSCTGCTDTCECSASFILVYDAESADCRPCDS
VTEFSPSIGGSRCEPTEECERGQEEVAAPTCCSSDRVRRDCSAGTIDSDSDGSMSSSPAA
RALTTTTATPPPSCMDVTECAPGFEQVRAMTLLISDRVCDECPEGTHKAVSGQGVPCLPI
ITTCDAGEEETAEPTPTNDRVCSQCELGATFKPVQRPGRVVPPPSASLAPSRSQALTLDS
ERECTLECSECPSGRFEIRACSALEDVQCAGCSACLPTTYILRACDSENDQHGMHDARRV
RPGPVLQFELFPTATPTTDRICRDLTQCNPSTEYERTACATSSPSATLASSASAPTSTSD
AKCEPCPIGTTDDDRNPITACQPCLLRPPCACGIHRLLQAVPVPGRHRRPGPQRQHTPCT
PCHVGVDFAALSGQRNCTPVTECDLGYEEVVRPTIFTDRQCRRCIEGLFYRDSTTDFCMR
VSPCEPGSFETAAPTISTDRECQMGRTCPNSTIEYELVAPSLVNDRECQRVRSCQHTECE
VSAPTATTDRLCATMSDAI
Download sequence
Identical sequences PTSG_11356T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]