SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11360T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11360T0
Domain Number 1 Region: 373-680
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.07e-65
Family YicI catalytic domain-like 0.00081
Further Details:      
 
Domain Number 2 Region: 682-763
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.89e-17
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 3 Region: 99-196,227-315,349-371
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000239
Family YicI N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11360T0
Sequence length 836
Comment | PTSG_11360 | Salpingoeca rosetta conserved hypothetical protein (837 aa)
Sequence
MMMRRCGGGGAAPVSVQAVVLAVLAVGSVLFVTAVDRSNFKTCEQSGFCKRQILDRPSDW
TSPYTVERSSVEIVAGSDGNGQQQALVFDLKDSRETKLLRASIVGFESDTLRLVIDEKEP
IRPRYRVQDVVSEDLVNTPAKIQKSDSSTDEHFVADVLVNHDVIGSIIVTYAPFRIDFMR
GDTAVATVNGRGLFDFEQQRERRDGDVDGMWEESFKTHKDSKPHGPTAISLDLTFHDAQH
VYGIPEHADSFALRDTERTKPYRLYNLDVFEYELEETMALYGSIPYMLGHSRRHTTGALL
LNAAEMWVHVQRSGASSPVHTRLLRALSSLFSSPSAQAGGDGNTASRASVDTQWVVESGV
VDLFVFLGPKPHDVFAQYAKVTGMPELPPLFSLAYHQCRWNYNDQEDVALVDRRLDEADI
PADVIWLDIEHTDGKRYMTWDRTKFPDPAAMQNALNVKERKMVNIVDPHIKRASVTVLMR
GRIPLDKYEGTTQSVFFWNDMNEPSVFNGPEVTMHKDAKHLDGREHRDVHNIYGMWQPAS
TAEGIRRRSGGHQRPFVLSRAFFAGSQKYGAIWTGDNTAEWGHLKASVPMLLSVSVAGLP
FCGADIGGFFGNPDTELLVRWYQAGAYQPFMRAHAHLDTKRREPYLLDEPEQTIVRSTIH
ARYQLLPYWYTLFHVSATTGVPVMRPIWAEYPEEEDAFAEETTHLVGGDLLVTPVTVAGA
TSASVYFPGSQPWYDVETGQSHAAPARKTVAAPLRKIPVFQRGGSIIPRKMRVRRTSGLT
HHDPFTLVAALDSSSTAEGKLYVDDYNSYAYATGSKFLIRSFRIETRGSDLVFTST
Download sequence
Identical sequences PTSG_11360T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]