SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11387T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_11387T0
Domain Number - Region: 417-461
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0022
Family TNF receptor-like 0.0047
Further Details:      
 
Domain Number - Region: 279-321
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00612
Family TNF receptor-like 0.0049
Further Details:      
 
Domain Number - Region: 460-497
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00698
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 375-419
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00785
Family TNF receptor-like 0.0071
Further Details:      
 
Domain Number - Region: 1004-1029
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0165
Family TNF receptor-like 0.0031
Further Details:      
 
Domain Number - Region: 979-1005
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0706
Family TNF receptor-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_11387T0
Sequence length 1246
Comment | PTSG_11387 | Salpingoeca rosetta thermal hysteresis protein isoform YL-4 (1247 aa)
Sequence
MFHWYGGCDDFCDDDCNAGCDYGCDYYCDSGCDSSCSTSCSSCDDSCDSNCTIFSIGCES
SCDSSCDYCVTTCDDSCDDYCDGGCDDGCDTCYSGCDSGCDICYDSCDDYCNGNCDYGCD
DTCAWTYCDDYCDDGCDTGCDGPCDSGCDDSCDDSCDTCTPISCDTGCDSSCYCNPGYYG
TAPYCSYCGTGTYMPYYGATNCYACDNCSPGEYRSGCGGSSAGTCRACASCPAGTYRYKC
GGQNSGYCRTCSSGCTRLTVCTSSQYEVRSQTATTDRVCRGLTTCGAGEQEKVAPTASSD
RVCEACPAGTTDANSDGSDACVTCGGGTYVPAGSTGTCSQYECSAGTADTDSNAGTACET
CDGATTYQPSKGQERCLSVKTCGAGEEETTSPSATRNRVCQPCQLGSTFKAQSGQSTRCI
SVTTCGAGEEEIASPTLSTDRQCRTCASGTFKAAAGQGTTCVAVSTCAAGFTEDVAPTPS
SDRVCVECAPGTFKATAGDGTCRAHRTCEDTEYETVAPTSSSDRKCKALTVCQDDEWESK
APTITTDRECSPCGRCTDGLTLDKACTDTSPTKCVGCDECASDEYTLSSCTLSSQTQCRQ
CTTCGSDEYQTKACSVSQDTECATLTTCSSTQFEVEAPTATRDRRCKDLTACQPGEYECT
AATLTTDRECCGVTQCVPGSEETSAPTATSDRECRQCVAGTTDADGSGTTPCVACSAGHY
VPRGRTGGCAAFECAAGHVDQDEDAATACKLCEAGVNYAGSAGLTRCTSVSECGAGEEET
SAPTASTDRVCSTCASGKFKATTGQTPCQPVSTCEEDEYVYRAATVSTDTQCRALTACSD
EQYETRAPTVNSDRECTGLTTCGSGEYETRAPTATTDRKCASVTQCDSTQFVVSKPTATT
DRDCAECDRCDSGTQYETATCTATTNRVCADLTVCADTEYESVAATDSSDRKCSSCRECT
SSEYLMSGCSESANAVCKACTECPSGTFVSTACTPLADAECTECTRCGSGYFVQSPCTSE
ADTTCKRCRSCASGEYLHTACTSSADAVCRKVSTCDVDAGYEVKAPTATTDRECRALTTC
DGESEFESRAPTLTSDRVCSKLTTCDGESEFESRAPTLTSDRMCSKLTTCTSSQYEKTAA
TATSDRVCSKLTTCTSSQYEKTAATATSDRVCSKLTTCTSSQYEKTAATSTSDRMCSKLT
TCTSSQYEKTAATSTSDRVCCRHCASVEQLYNCTADHPGICTCAPG
Download sequence
Identical sequences PTSG_11387T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]