SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11500T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11500T0
Domain Number 1 Region: 9-72,132-199
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-17
Family Asparaginyl hydroxylase-like 0.034
Further Details:      
 
Domain Number 2 Region: 643-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_11500T0
Sequence length 718
Comment | PTSG_11500 | Salpingoeca rosetta predicted protein (718 aa)
Sequence
DLVDFPAEDNVKQLQEGVRDVFGTESTVHLYHATQNESRALMPHTDPYDVLVIQLHGSKR
WTTCIPDAYATSGSDDTTEDHSDSHPDEKAASSSNDQQQHGHGEAETIKQFNPAQLGQLQ
EIRRQKQEGCTRYEDRDLRGMRCNEFTLRAGDTMYMPKGIIHYAVSGAEGSSHLTISLER
RGLAWADALVYAAHAGADIVDNPAFTKHWQRALQSLISDYRGVQLLEAMPSWHLNTGALC
PSHDATKEKDDGTSEEGTTGGEEGEELTAFIGSFMAQCEAMLPHVLESYAKANDLEAFLN
PDGIEALADRVCSEDTARAVVSELCAQGKMPVDVTSPRFRKEALACLPYCCHVTPLEHST
KALTISSAVCYFVVCRQSCTGCDDSCNTLCDDTCSSCDTSCDICYGQSCSSCDLACNTGC
DGGCDGCDLYQCNSGCDSSCDTLWWDCDSSCDESCGWTSCDYSCDDYCDTGCNQGCDYCV
ATNCNGGCDDSCDGPCNTGCDGSCNTGCDECVGISCDTSCDGSCSCNAGYAGSGTSCSAC
NTPYYSPSAGASSCTPCGSCSSGQFRANCGGTSGGTCTSCASCPAGQERRGCSGTSSGDC
ANCNPETYKTTQGTHSCSACGSCSAGYYLSGCGGTSAGSCVGIACTTPPTVNHASFTTSN
SRKYPSTATYTCATGYLIESNDKLSCKTDGSWSGVTPHCIGVPCQELALDHGSVSPSG
Download sequence
Identical sequences PTSG_11500T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]