SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_11510T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_11510T0
Domain Number 1 Region: 50-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Weak hits

Sequence:  PTSG_11510T0
Domain Number - Region: 92-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00278
Family Complement control module/SCR domain 0.0068
Further Details:      
 
Domain Number - Region: 3-38
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00653
Family Complement control module/SCR domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_11510T0
Sequence length 271
Comment | PTSG_11510 | Salpingoeca rosetta predicted protein (272 aa)
Sequence
MATCQPGYVGPASPFTCQADKTWGGNYTDACTPIDCGPTIHNADALNVTATCTGDTRYTG
DACTATCAPGYRGPSSTFTCGADGKWTGSPQCEPIQCGRPALLDSNVRLRCFDTVALGRG
CRTSCAVGRKEGTDFTCNADGQWEASTASALEGGTLIGLIIGVIAFLLLLVVVVLALRLR
SNRTRPINGPPGMTKGPGVAETSMYTNPTHSSFRNRKLPEDHYSVYARAAMTSQPPRPSA
PKPIGAESSTDYDAMRQTSFRKLEPGLDVTT
Download sequence
Identical sequences PTSG_11510T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]