SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_00710T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_00710T0
Domain Number 1 Region: 459-518
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  PTSG_00710T0
Domain Number - Region: 533-594
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0017
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number - Region: 1471-1509
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00483
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number - Region: 620-666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00693
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number - Region: 400-445
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0536
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number - Region: 755-814
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0785
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number - Region: 914-960
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0942
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_00710T0
Sequence length 2557
Comment | PTSG_00710 | Salpingoeca rosetta conserved hypothetical protein (2558 aa)
Sequence
MAAAATSRRVRPQVLLATAVIVLACLAPCPATTAPGAVDIPSSARILVWGEDFNDVPIAT
GIGNDTTPPAGSLSWNITAAQPPAPRGYFKVVPVAAGAVDHVLEAHALGTSARWSTGLFY
TECAVNLTAGIHLEVHGTLQQADSLVVYYLTRHDDSGGGGTTTTTTTTAGTTLITPTTTT
AAATTTTTTAIPQASTVSMNTTAAATTTMRTSTMPPPTDGGSGSGVDPGIFLPHQSIEVA
RITAATVKQQQQQQEGNGTAGGVWEDHVLFFSDINANYVQLGVEVVLGDTSDATFVIDNI
TLHAAAPLREEAHWSPWSPIAWSNWTQWEPQECNVNQTRTRTGTRTRTCVVPNCAPPAST
CNDGGASEEVAQTDARPASDNCCGPVHGGWSNWTVAPSLSGEWTEWSPAQCGVEQQRTRQ
VVATRTCTSPAPLCGGAPCAGNATRVTTEQDTRTAADNCCPVDGGWTAWLAGEWSPWSAF
SPDTCGVEQTRTRIRRRTRTCTQPAPACGGLPCPGNSTHIDTETQTRNASANCCAVDGEW
SQWAPEEWSNWSDYTPSECGVEQRRERLRTRVRTCTDPAPVCGGSACVGSPTATDTQSQV
RTAEENCCSVNGNYTTWRGGPWSAWTDYSPAGCGVNQTRARTQVQTRTCTNPSPACGGLA
CTGPDTRDYVDIEYRTAEENCCPVDGNFTAWQTSEWSQWSAYTPDVCGVAQNRTRRRIHT
RNCTAPAPSCGGRDCVGETRVVDTRVGTRTAEENCCPVDGQFGEWQDGSWTEWSEFAPEG
CGIEQSRFRQKQQTRECNNPPPSCGGVSCSGERVRIVEDVERRVADEYMDGGWSDPMPVS
EWTEWSQPWPADCAGPQTQNRTRMLNRTCTNPAPQCNGRPCEGDATLVDIQVRNVTWQPV
DGAFGAWFAPDGSEWSAWSAFDPPGCDVAQQRNRTRVEVRTCTNPAPACGGRDCVGATTR
IAVQVENRTAAESCVPGCVRNATYTPWQEGSWSAWEPPLDLLLCDTPQGQARTRRRMREC
VAPVCGGQPCTEDLAEAVTEQRSMTLRNLSADVSEWLLGNWSAWTTPNPGDNCPLVSNVW
VRRRQDARTCAIPPNSCNQDACAGVSTQRTVRDWSLGPTAPSSQPTAPTVPDAGTTTTTT
VTAPNGTTSNSNSTASNQAVFRSQDCCDGFQGWAVVHMSEWSAWGYPDIDALGLPCNSTH
EVQRTRSRNVTRACDAAGTPCASRVCVGDARVVEDDMQTVPVSALQDGWSSFVFGEWSDW
QFVDTIGCGQQRVRVSKRVGVRTCTSPWPSCRCVGPQTVTNVRNETVYGEATCDSACRVD
GGWSLWVSQEGSWTPWTPWLPKGCGVEQRANRTRTLVRSCVNPSPACGGRDCEGPSTTVD
VAARKRSAEDNCCGCITCQPGRYLDQFEPSRTACRPCPAGTVGDGAQCAQCSPGVYVPEG
SVPDCEQYACEEGYTDHDFDPATPCVPCSATGCPSGSFPLYTCTATQDLRCAPCPPDTFS
PDGVACRACDAPCENGSYAASVCDGKSNFQCLPCTPESTCPFGVKRPCEALVDTTCFASP
EEANASNDGDSGGAGLSQAWLIVVLCLGGLFIATNCYWVGRSCNRTKQSDLYPINEMEMS
TLSRNGAVVKLPHTAGVAPVYADGDSDSGLAETPLQAWMLPGHNASPATARRGAEPASAK
LASPQQSGGSAHTATTTMTAATGQTSGAAAGASNSQTSGGSTGGGSWWSRFTRHRSRSPA
APRSAVVLPTRDFSGAYGGDGGHVHAVNTGHVALNLPMYTDADGMQAALESRTTPSPQQQ
RRRPAELRATQRRKPGTRPKLYMQAYQPSSASTASPSPRLPPRRIAGDESGSSICSVDPS
PDYLTAAAAVVQPKESIYATAGASTRRARRMTQRLQPSAGRKVAVGGASGNGAHAMSPHQ
AFGPSPTQPRVNHSDSEGDADASSVDSDYCVPDDARDVEDPPYARANDVGIYSSMTRSGT
VKSGRSDATDATYARAEDFPQALPASAVHTYAEPVRPWRQHSSTTLSTSGQSVARDGDRS
RAHFGGGDGDDGDMVLASPDDVGGRERRHSSSSQYASLFGEVREVAVGSGEGGGRGHAGR
DSDYDHLDRSGDVRGSVWANDERPGPLVLHDDEMEEGFYSIFSAHATNDEEVPARVRQVF
NNLKRQHTQPHSDEDDDDDDEEEEEEEDEDAEDDFGGVGGGGIGGEREGARQANGSGQQQ
LQHQQQAEGRGRRGRGRSSRTSVSSQGGCTRASLASEEDTWVPGEEGPMNGRGGGQGTAP
ATATTSARASSSASSLQGGNSKALSSASSRASVLASHQAMPPSTAQSGRQVGSIDAFIAA
FAKDGNNNPPKVQQQQKQQQQQEDGEIGTSLTTTATATVTATATAPETETETETAKPKQR
RLSLRRSSRKKSKDKKKKSSSSSSSSSSSAKPRPRSEADIRHIVFVNSGADDEEAGGADH
HHHRHHQGQQGHQEHQQRSGMREGKQRSRGGGKNKSMTRKKTKPRPRSEGHESPASDVPM
AIPTATPANPPKPKPQRGTTTSTDWFSSFVRQHAGNE
Download sequence
Identical sequences PTSG_00710T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]