SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_01976T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_01976T0
Domain Number 1 Region: 2737-2821,2877-2940
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 3145-3282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000673
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 375-513
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000419
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 230-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000883
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 1146-1307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000196
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 2430-2580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000288
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 1558-1646,1675-1737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000593
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 78-220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000366
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 9 Region: 2025-2117,2153-2215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000392
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 523-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000432
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 11 Region: 2230-2350
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000105
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 12 Region: 899-1047
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000732
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number 13 Region: 767-910
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000112
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 14 Region: 1760-1856,1887-1949
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_01976T0
Domain Number - Region: 2966-3104,3149-3187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000102
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 1035-1173
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 2557-2700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000463
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 1348-1373,1399-1446,1474-1538
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 3462-3509
Classification Level Classification E-value
Superfamily TNF receptor-like 0.02
Family TNF receptor-like 0.022
Further Details:      
 
Domain Number - Region: 3290-3404
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0204
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_01976T0
Sequence length 6237
Comment | PTSG_01976 | Salpingoeca rosetta conserved hypothetical protein (6238 aa)
Sequence
MRARPVSHDRTGDTIAVPPTAPAMTAHTACPGGTWRSHSSGCMKSRRKTPLLPLPLLHAT
VAAMLCILFLTSAGTVRAATSCQPGEYLNINATCIECLTGYTCSGGVSAAMPCPTGTYNP
VPGQSSQALHCLACEAGDYTTARGSTSCQTCPAGHTCADPAAEPTECPQGSYAPAGSTTC
KACPAGSKCPYAQLAAPIACANGTYALANQTSCSLCPAGYSCPDASAAIACGVGYYSPQG
EPACTICPLGTFCASNTTEAPELCAEGSYAMLGQEACTACPAGYYCPHADEQPVACSNGT
YTSSTGAITCLVCEAGRDCSTKTSSTPCPAGTYSGQGLPSCEPCAEGYYANATGLSHCLP
CPPGYTCANPAYDPVLCSAGYYSEGTNGTSGAVCIACPRGTTSTPARTGCDDCPQGHHCN
DPTIDPQPCPAGTYSAGGTVKACTTCTAGFYCPAQATQPLPCVSGTFSGAGASNCTACPA
GYACSSTAAVPVACDAGYISDEGETTCRPCGLGNFCPSSTEGPYPCPVGTYTVNATSQSC
LPCPTDHACPSATATPVLCSFGQTVSATLTTCEPCPAGFSCPTPSSTPQPCTPGNYSTEG
SGSCTACPAGSACPTTSASPEACSPGSYSTEGSTHCTRCPPGYECPSTADTSLIKACRNG
TYALGSATACELCDAGAYCPSTSQGPQGTCPPGTYSLDGQASCTLCPAGSSCQYNDRDPA
ACAAGSFSEAGALECTVCPPGFACPYTTQAIMHPCDIGSYSEAGSTTCNVSGSAVNVCPA
GFACPSVYGDTRVSCATGWFSTVNATSCTPCPAGYKCPTSDSDSRTACDPGTYSLGATDT
CTDCTAGSYCPSVALPPRVCPPGTYSSDRATQCTACRAGYFCTTTTETLCNEGFWSAANS
TYCEPCDSGYLCDAGTRPHTSPNGNPCAQGGYCNGATRTECPDGTYGNVAAKGTLHEACF
ECPAGSYCDGTGAGATTPTACPAGYYCPAGTGRIDLQPCPAGYYALSGGSKESLDTGCTL
CPEGYYCPQASVNPIICPQGYFCPTGTEEGTQNSCPSGTYGATVGFSDASNCTICPIGYY
CPDGHNTHPSVSPLPCPGGTYNPFTGAGLEVDCIPCPSGRSCSGTGRNNTNPCEQGHYCP
RGTVTSTQYPCPPGTYTDSTSLGAAEECSPCPAGSACGWATGYTDNVPLSCSQGHYCPTG
TPTPTSFPCAAGTYTARSNLTAASECSTCPERYYCDGGEGSPTDWCPSGYYCLAGTQAFF
QHPCPAGTYQPEIGSYLESECFNCTVGHYCEEATTTPVACPAGTYMPYGSERNDTMGSEA
SRILSCKIACRDPDDFVSLTTVAELEQCELACEQGSNCATHCGTVSAEYTTACNHGCDSY
DSAAAYVQVGVSAGAASECITCPAGYSCSSATVDPVPCGRGFYSEAGSEACERCPAGYYC
DEAAVSDTVLVTSKACNSSLYCTSGLSAHDDAVPCPRGHYCPQGTALPVTCPVGTYNPDL
YGASLADCHPCDAGMYCVEASVNPTGACNKGYYCPTNITASEVLNGVSGLLIGSYGPKQE
PCPAGTYRNATGGQDLSSCATCPEASYCPIASAVPITCPRGFYCPLGSAQPQPCPKGTIG
NSTGLIAESDCEACPGGFYCDRLGSWQTTAPCDPGYVCTLGAVTSAPTDNVTGSICPAGG
YCPPGSAVSQPCPQGTFNNVTGSVDENDCVPCTPGYYCASTRSPGPTGPCDAGYYCTSES
KDRRQFVTPVGHYTTAGSSAPIPCNPGTYQTATGKGSCDPCPAGTYCPDFGMNSTVECPR
GFFCPEGSTSFSGPNGNQRCPIGTYGAFSGIANTTGCVDCPPGQYCASPEDGSGLMEPTG
PCAAGYICYGNAEFATPGLDGLSWGAVCPPGYYCPEGTQAPVPCPPGSYSNVEGLQSESQ
CTPCPAARYCPEEAMTTYGAYCAEGYYCILGSAVARPLSNNSVQLRGLDSLDYYYTTQNL
TLNTTRLAACGLLDFGGDVCPQGHYCPTGVEAEYIAGFPSFVWEGGPILCAEGTYANFTG
AAECWTCPAGFACFNREPFDANPLPCPEGHYCPQGTDSNIPECPVGTYNNRTGLQAETDC
TPCPPGLACTVTGLSDPDAPCAEGFWCGRGAFSTRPRTSSPLAATTPSFDGGQCPEAHYC
PEGSSAPTPCPPGTISAAVQASSNATCTACPPGFYCEAAGQTQAAAQCAAGYYCVSGATS
PRPTDGVTGDVCPAGTYCEAGSHTPANCPPGSYNALTGQSNCTTCPAGFYCEEGASDYTA
TPCDAGHYCPNGTAHSTQVPCPVGTYLNTTGAATEDACVPCTPGYYCPTTGLVQATLLCD
EGYYCSGGSHVARPQVNGTDVATCPGISAGGMCQAGTYCPQGAPAPLPCEAGRACTTTGL
SASNKACSAGFVCLGGAQTTRPTDGVTGYRCPAGYYCPAGSSEPTPCPAGTYSQASEASD
SSTCLACLLGHACTAPATTSPEACDAGYHCSVLGLNTTSPADLLCDPGYYCPNGTTQQLA
CPSGTYQNEAGMATCKECPAGFVCDATSSPVVTGTATPCPVGHYCPAGTEVGTANPCPVG
TIGNETGLANVTQCHACPPGHYCDEAGLTEPAGECAGGYYCQSGATTPQPLDGVTGDVCP
SGNYCPQGSINPVPCPAGSITTLLAQDEVGDCQPCDPGEYCPAGSSAGDCDAGYVCVRGS
ATAQPTTLAFNAELGVLTGGYMCPNGTYCPAGAISDTPCARGTYAPMPGLEACTPCPAGQ
LCEELGTINPADCPLGFYCEQGVVTPEPCPIGTFGGRTGLRDVTECTLCEGGHFCDETAL
TAPKGECDAGYLCAGGDTTPAPTGPTTSILGDDTNFFSVAFVTIFIDGEELNVTSGTCPR
GHYCTNGTASPVACPAGYYNPDRRGASLADCTPCPARYYCADTGMTTYTSTCAAGYYCPE
SAAIATSQPAGYECPLGHRCLAASDAPEPCPDGEYQDVEAQSECKTCPAGSVCEYGRNSS
VTPEPCPLTYFCEAGTGLYNKQLCANGTYGAATGYAQASDCVPCPPGKYCNLGVVEGNCH
AGYICLSSSTTPQPSGDDADVGSPCPAGYVCPEGTLSPQLCPNGTVVIEGLEQQQVVVTA
VNNDGDLISVTRNITVPTLGEGAASFDACDTCPASLVCAGAVVTPCPTGHYCPAESSEPV
PCAAGFYNALPASDDPTDCSICPAGYWCRYEGTSDFSDVPCPQGYYCPVGTTTPRACPPG
TWSNETAAMSADDCQECPAGFFCPENATTRVVDVCPSGHFCPAGSAEPRVCTAGYYCPTQ
SGEPRPSPDGYYSPFNSSDPIPCPAGHYCPAPAADASTVIGDYPSGATEAILCPLGYRDR
VEGGGNHDRTTLDSACVACEAGKYGSHPTRAVCFDCEPGFVCLEGAIYGNPDVWTAVNAT
RDRIVYVNGNPYSDVVALDVLPYTGVGFNYTVNGYPDTKSYQCPPGYYCPRQSPYPLPCP
EGTYNPNNRSVSVDACVSCPAGTYNNRAGQSFCRSCGSSSFSDSGASLCTCRGENRVFSP
ADATCVCRPLYASRDGATLLTDVEDGVADCQPIVFDNCPEGSVLNEHGQCLDDSGWLAYC
QAECALGPTPSVYDAGLGRCLCKTPALDDVCDISCRAEERQRQQIVCESPPRLVINQVNA
DGSVDEVISIYTSELGVGALGDIGLDACPTLDGRRLPSFLMVANSDGLTGGYNVPTTVWE
GLDVSGASRRRRSSDAAAQSMDGAQGAAGHAGSTVLSSNLTLTAAADGELPRARRPHVRL
RREEWVAQLANPVACLELGAVVVFSVNGTNYPVYDKNNLLNRQDDPERPFIHAPLVALAE
ELQSDPSARSFAYAFTSPGVWVLRDAGSGRTSVFSVMGENVECPDNGPFFPATSSSQHLL
TVSREDSLVVTPDWRLMGFILAGAAALVMVVLAATSYFRTAGWVVEGQRTVSYRQAATRY
PIEDMSSKGSQRERVQRINRKALEFDLSDPANEPPPQGKSTASNNNNNNNNHGADADADA
AGAEGTKEGVSQRLKVLFDDDFWDYERQVDLENFTAETLFDLIDGRTQEVHRQIQAKSDE
VKKVYENIRHEASLLKSLWVSKLRLARPVELSPLPPGQPSNTQTLSKARDGYGKELESRK
SLGDRWYQALVARRDMLARTFRQSNDLYQDVLSRVEEVRTQVNLVIALQRFAQQQRMDNS
VVAEGRVRCEQAVIGLREALIKGTAQLLCSSLVGESDVESFGARLLPPEDGGDEPVPTEQ
LRDPVDGGLVSGEFIQRSEILPGLFVPVAGTRLLLADGSVQPCSPTEHVVDPRTARVLPV
RGNVAYNMVTRQLFVVVDFTSISTHSAPLLYVPWPAQAQAQDKACAFSDGTPLQSSLRTD
GTMVHAATGLTVPMLACTTHPATKEIVPVGGVYDDPVTHLPTPIQRYLPGPASGHANTII
VDVDISDEGDAVPVCVPMGNLDTHTHIASEEPLSGRVCLSNHVSLRTSAASPSGSAPVMP
KPHGVSWVSGLDALCLQSYRSCLTEVERLPVLLADEALDPLALSSSLASAVSSMDSQLRD
VHSIFKRTARLKHSLFSDILLRFAEALSIREDGGVLGHLDEGNVPLFVGQRLYDRESKLE
VPVLGVAYEKENERHVPLGGVMHSPDTGELAPISIGAAYVDPDSGEKSRVQGARVDPNTG
RVVPSRQPCVRQRTFKLTDDDLARLEEELAARRAWQRRTTNQDNGLLRELQRLMATVLEM
DDSETSKVSSHLETLAETLTSRSQQMRREQKRRKEEEGRFDEFPGVLTAMLFSNDKQEAS
LSVRHLQQFENVLGACKRFLAACTEAQEERDNAYLPERDGADNTDLKDKAQTAFENALDG
ARLELLESLSMQLAHVHESRATLQWISVDDELRASVVKEILGKMLRQQDRAQSGEDDGQN
TMTSLENLISVLQHQASILRTQSTTSTTGLSASGRFTLAQLREEAEETAPASTTPPKQPR
MAVPAIAVVEEGDDAETDGTSAGLQTQQAEQQQQQQGADSGSAALEVGKAGGMKKTDSKK
KKKKKDKKDATGTLASKELEKLVEIQTQGRTALDARLYEAEREEMDKLLEKLRKEEEDKL
GELTADLMRKLVAAGDDEAAQQKLLDAYEEQVATVRKQHQAKADMQVAELMQRLTRIRYD
ETQRHYQRERDTLPNHPDIAPPPNVTEDDVQAQIKEMLLEQQRLIASLEAGKRASAEEAD
QDGQGGGAVVDFDKRMEAFANSLTNKSTLRGGDKDAEALAAASTTAKKEVASRAKVVTSV
KGRLRAKLEKRRAEAVGKAKTDEERAQVEASYDSQLATLSSHVTKAVDDELARTQQQLVK
EFVAEDKQEEAAQMLREHQERMQQVRDKVHSDQRDKVMARIAAQKRLAAQRRRERMQKQQ
QEKLAAASGSGDGDDEGSKAKGSAAAAVDDGSKHARDLANKVAAASVSDEEAKKRMAELE
QAHLKRLEELEAQKQAQMKELSQKVDAEITEAQQKAEADLQKRREESMQAAEQRMREEQE
RAKAQLSPEEFEKFMNKHRQQLSEVQSRLDKTQQAQRQALQERLKKQRERRRKANESKLE
EQFTTEMSKQSEEREQLQSDMERANEEKVLRAAVKDMSNSLSVDSAAGGGGGGGQSTHRD
TVIHRVMRARHLREFGRLVERCAVDMEARLRQDVGNFREERAEEREKIEERYEAELAEVE
ERDASAKTGSRDERFKIRRKLKTALANFDKKTARLVEQLEARVRLSANTDTERRKLELKQ
RQYNEMVEAFKNFSPDSEVHAQYEEAANQAKEAAEEYKKRLGAERQEQMKKLKEEQERLR
KERHEKMEAERKRVLQELEAERQKQEQLMQQKQQRNKKKMMEQMRQQQAHELEKLDEAQR
QEVMERHRRGLKNLEDALESEQDRQRQKFRERLNALKARKQEARLRELEEKEEEEQARAE
EEFMAKELELQQQLHSQVQATVRKRDLRPTTPFVAGKGKKAKQPGGAKKQGQRRKSRAAA
ADTAAVSMLDEGLAPMLSKIESIEALLAGYDGAVAGQLGDDVEEEWASRSGDAALFTNKD
DDGSAGEVDVVGDDEATQRQRMSLQLAEFVCRVARERRWLDNDVRLQLAKRLPAPVHLQN
AFRFSYAYNRDTRTLSVRAQRADEPTQLLLVVIHALAHIKVDNMDGDHTGVFRKAFHSLL
RLVCFDVLLSGCIAPASADGGDGGDDADRLQLLLHGLQRQSQSSKPLVKLLDDFSHA
Download sequence
Identical sequences PTSG_01976T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]