SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02092T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02092T0
Domain Number 1 Region: 971-1010,1096-1202
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.67e-20
Family Regulator of chromosome condensation RCC1 0.028
Further Details:      
 
Domain Number 2 Region: 3969-4031
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000636
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Weak hits

Sequence:  PTSG_02092T0
Domain Number - Region: 3274-3326
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00051
Family CBM11 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02092T0
Sequence length 4218
Comment | PTSG_02092 | Salpingoeca rosetta highwire (4219 aa)
Sequence
MSKLSEIAAPIPLRSHAIQIHGEETENKPVSKTDKDASTLGSTPRSSQQKLAVVLDPVQV
IDMQLTPRIVISQLESDDPAEVNKAIEHCISIAQYNQAQLSQKARYTQLLIHSALTFVDS
TKYPAVNDAIRAFEDIFSMTRSSPSPTPSPSSSPPTPASPPALQLAHADAAVAELSMLSD
LRRAMFTLASMETEPSAVPLLTLPLRIHDPSAAVDTFRPSAAAIDPSIARCFVGQPNANA
CHLFEQHGAGVPGAFLLPMAPSRRRRSPLDPPARTDTSEAPQHIVCTAKPGPLVLGRRAN
DAPGIIRNLDPSTLDTCAVFEQEPGTPPDDVSGLPRPKPRRPHQHHHHQRRQRQQQEALQ
AQYGGYERLLGEHLVALVPAQEHAFACIDFVDQHYEMRFFDISQQQQQAACTEPKLVFRA
VLCMPLTLGKNIMVQVSLADFQVQKNQGVAWPVNILINPKASKSQSGNGNGKGSSGSSDN
GKGSSENESRELTDSDMLFLLPNGTVTTSTGSLMSSIAPGEHVKGISTTGKRGGIVVHTT
AGVISMNKDTTAFEHLRGYPTPHALEHVALYGRQNAVVGVTRSGALVLRHVRVCEGLWSP
VVPVIIDRQSPDSLSCRPARPLLLRLHGTATAEVTNVHVTDTHATVTVRVAAEHEAMAMQ
HLTLTGSAVEAVAIDKEQGPPAMTSTGADGDGNANSGGGDDAASKAGGQTGLAGKGKRRK
QKASGPRVTLVIKARLGAVHEFGKPGSISGRAGPAMAAMMQGEQPTISLASKEDALALVH
HVSAPVRDMHTEEVTADSPFTQGSNLKSSEIGMSGKQLCSSAACFSWSWLITDEGNLSFG
VSRVAESSIASIVFAAEPPAANFSHPLQCALVTARIVFFAGWHYFEVIVMPPPPSVKDDP
SYEGSGRMCETTASYRMRLPKIEGTERLYVRLKAKARAKPVACPIGPHSPFHLKHVSGEA
PAEVALAKTRAVDVVSGSRHALVLTSSGAVLSVGNNAFGQCGRSTAHRGLRVRRGVCDRE
GHQMYPDEMKHVCTSCGRWGEDAASETSEECALTPGRRRAKVATTSCVRCYRCADCVDKK
RLLTDTLLDTLDAYVALGAIELPFARCVQVAAGRFHSVFLSQDGDVYTCGLNNGNQLGRE
LAFEPAQEGFGQHVPCLPHTSATLAKVTLPDAASSPVLRVRACGDLSLLLTKSGHAVVCG
GFLPSKCIDLQATLGVSLYLNNARPGQRHTAPGDSQLEVFVRSDKQVVAFAHTEWLQDAQ
EKTRVIGGVCTDYVCLLRQTSPRLKPNVWEYVRVFKSELASLQKPSSCTITFDDDFEPVG
FVPELPVVFGWTKSSPDAHTSSSSSSSSNATASTARTKHALQFRLMHDAPLMEQTILSAN
KQDPLLAKTIANITQLLHNPFFTSGEAERLRRDLLPSLRQSARSAAYACGMHIKRSAHAL
TAVGMRPEDHMPEFDLATITIVVNTACLVRFALKDAEVSSNSFGDTPRRRHLLAPNTPCT
VTIRRKGHSPCQSAFDCETVLPAVVARLESTSRFVCGLLRIDITELSPLEHALLPLEFSL
FCTSSAVAGAYDAATALRTHLAAAAAGSSTDTTPQGHMTNAIIAQTQLAAIAVNISLLSR
EEQPVRQGALHPDLPGLLSRCLMQVAELKVSAQGADLQQWQRAFHQLMDIVVILTDRNSL
LKRALEQFARLDARESFTLADVAQAEVVAFTLNRCWEHVSSEDLFSVLGISTLGTVDDAD
KLVCLFQSFFDFTKKTGASARTQFFLLIRSCLQAMVQWTGDHADKKGAAVFLTELLDLLL
DELTAIKAGGNAANEMELLSSLSSLLRVCSKWVNNLGSSSKAPIERLLRSLIGIYTVVAG
TNRDALAQQPSPSQQADVYGSEAFGHVCTVESAHPYTHGLVEVKHVSFKKPCMVAIGFHS
SCSLASPEDRLSIVAETEAGDKTVTVTGSDTFPEAFQVTPATRVTFRLETTTREGGSAED
DSAAFGYRCQVVAFPITALDKTVDSPTRDTIETQASSLADVTIKLCKRVLGDVTSDKDEA
QVAQVALTFNPTFHGQAVKIEDRAAATKAGRVPGQIAERPEGHNRACCFSLFPIALKDER
KEFAVEVMESDAAKAGGMAMGFVVMPKMEDEYEKPPLQRLFKSIPSSAILINENSLVYVA
NSEAYKGNNNLGTVSKESNFLHLNTVTAGEKIKMWANKEGELFIQGPSQKDPAKIPLPAK
VDIEQDLYAFVDVYGRTQRVKMTGTSEVRLEHDPAYPRSAPCPFCKAAMVMTRGYADVTC
EYGQQIPFGARYMLCPKCLTTSSLSGAFAMQRKVNTGLVEKLVPIANMAFTKLRPGVFAL
DTTFDRGLLTWELQVLSHRVCALGVQTPTQAALKKPLGVFIDCKADVLQYGKATLMPWPP
TERTPRSFMFVLDCSSGVLTVAERNGPTKTLQVAPGSQPCVCLDDDNGSGAGIHDSNAAD
NAEDGSTSDAFAITDHVRIATLAWSYGAEDVLEASKFLPLRDVPVYAKQKMYARMYDESE
VLSASAECNTACLVNLFSHTMQARLLAHAQAPSSLHGLVVEVHLAHVTAKDGVMRYDPTC
DASVIVPGRLASEDQDSTAVYVDVPVVNTENQLVTLDSLAPLRVFPVGTAAAHGRSVSFV
NFPRLGSFGWPEYLALTQQSPLLPWMVPSDAPPQDLVSLQIRIGLELSSFTCLVPRELVR
RYATTASEATPALHRLVEDAAFVLGHVQLSRIGQKSAEELSRLASVTSELLRFEPALASH
SLSALQHPLEAEPFSALELMGAGVSTSPSRQLSSSVGLLRTPSSSDAPPSPRRAGLRRFS
SVETPVPATAATGAPAGSALGIARSVKDMLEFFEEVQVLVARVREGASTEDWQRAFGDTE
DAAMSPWTSIGVLNFLARTTTRVDVLASVLSAFSSLFATRSTATTYYDEDDAETPAAEDG
GVGEEEKGSGSSKGDQANKADARKQQDGKDGEDKDNKQHQGNRDKKGKKQGDGGGGDDDD
DGEGDKPKNADGRGTEDSQAGVTAKRRKLNLLEESVNAIHTLDLGHGLELRASRTALIQF
LSMVAHMGTSLPPAHPLQRLAIRCWALPRVAEGEPQLLQGTHVLSWLSKLLLMEERSSPS
AAPSPRRGTTTISRTRTSSAVADVGGGAGKQGGAETAGGNDEPLAEVTADKKENEDEAHV
RGEEGQEGKVEELKEDEVEEDETTAKGKGPDGSRGDGGDGGDGGDSGGDSSKATTTATST
NATARTSVSVSHANAGDVNTEAEAEEDADGAIFGEDEIDVTPHAKVSVSSQPDMAGSLVD
GRTDTMWQAQGGFSVNWIKLTLDPAVLREKVGPNVGPPKAVYVHVDPTRDPRDRIPTAIE
LQDLTSSGMDKPVSVPVPSASKRPMWLMLECPAQSSGKLDAVVELKLVLKSRSEVRVRQV
RVCCGAGSRALSNEATMGHPIHCDALVLFKLLSAGLLKSDAQTLIGRGGAGDEELLGLLN
RDTALNTGPLQTQMLKHIVRGLKVETAAVVEACCSSPAEHSGSDTDTQQEEALELESREE
YVLELLDLLRDALSRSASAVPSMAVLKLLYQLVHCASTRVQSAAVNLLRVIAPRQKYPSL
PKVDVVSFAGTAIAVSHVRMLLAAVAKIIQVQLRFRLSEEGGGLTSTTQQLSLKQLCGVE
EHCLPSQTASLGLSRQASIDPTAATAKTTDNADADTHLVEAARRIKQQVSSWQVAGDCAG
AFKDIVGLVSFLLRTSAWQKEVKDELASLLLDLNHRARTVEGEVESMFGLFGDYSTWLAA
AALAVLTKTTVGGINKTIRQLEGNTFLCQHHDDGVTAAAVFCHTCHAHYCTYCDKFAHLH
PSKRNHERKDIDQIETLSVEWNDGYTRIKQPSFLILVDPVNLRSIVEFRPTKKFVDGTAR
QCRFCLAPVDGAEGKSADRVVCASAECVEALANVCQRTLPCGHACQGLRDEPTCPPCLQC
AKAAGLIQQDADDECMVCFCGCLREGPCIMLGCGHIFHADCIFRMLKTGWPGPRITFDFA
TCPLCRSSLLEGEPHPLLATMLAPIKALHADVRRKALMRLQYDNEKVEGTEEKRAARAMK
KYTYYKCFKCSKAYFGGEEACAVGSNDFDEEELVCPACSGGEAQQVCPKHGTDFLEYKCR
YCCSVAVFFCFGTTHFCQPCHDDYQRCLDCPKANLPKCPAGPKLTQLEGEECPLHVKHPP
TGEEFALGCGICRNAQTF
Download sequence
Identical sequences PTSG_02092T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]