SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02230T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02230T0
Domain Number 1 Region: 26-315
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.47e-48
Family Amylase, catalytic domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 431-506
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000027
Family alpha-Amylases, C-terminal beta-sheet domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_02230T0
Sequence length 510
Comment | PTSG_02230 | Salpingoeca rosetta predicted protein (511 aa)
Sequence
MVAVRASGVVVVAVVVLAAAVGVQARPGSKGIKPLMGWNTWCTQNKCGVDWCTSDEVLDV
AKTIKASGMLAAGYDHINLDDCWGLRDPKTHEIKGDPVRFPEGMKAFIKKIHDLGFKFGL
YTDLGADACHSPFTGSYPYYAQDAATFKDWEVDYVKFDDCNLPDGHTKEELSCDMSSELL
KTGRDFWLCFHCDWNSDTCAKCGTSFRIAHDHHDEWDSTSSIIDVLAHNRQPYWGPNPTY
GLPDPDFIFTGGQGCGAHSPPGTRCPGQTEDEYMSEFSVWTIAGGSLLIASDPRNMTDFM
ARVWFNHEILAVYNDSASLQSVRAIGNGTLSHARHTMHLHAQRKQEQEQQQQRQRHDLKP
LASCALEKQLSHDPCVQGVSFGCNGDETMWTDHGCRGIFTCDGVQDVTCNEDGSGKHTCK
CVTTPPPPSIVLARPLSDNSTVAVVIHNAAMVNQTLGFHFSAVPERAWNSKTTLHVRDLW
RHADLGKATGSFSTFVPAHGSAFLLLSPAS
Download sequence
Identical sequences F2U1L0
PTSG_02230T0 XP_004996716.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]