SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02374T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02374T0
Domain Number 1 Region: 100-142
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00004
Family TNF receptor-like 0.0047
Further Details:      
 
Weak hits

Sequence:  PTSG_02374T0
Domain Number - Region: 41-171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000167
Family Growth factor receptor domain 0.0075
Further Details:      
 
Domain Number - Region: 160-319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number - Region: 968-996
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_02374T0
Sequence length 1082
Comment | PTSG_02374 | Salpingoeca rosetta predicted protein (1083 aa)
Sequence
MRLVVRTAVAATVAVLTIAYALSSLHCTAYEHYEITAIPFLDYCKKCTFGRYKDSVGNFD
CYPTRRCEPGHRYKHVSKNQDATCPACESGKYQAKVNHRDDNCYTWSTCAAGKYVKQSAT
TKRDRSCDACPAGKYTPRSNRLTCSDCPSGKYQDNSGRSSCKTSTTCDDGYFSISEPPTS
DRICAKACSPGKYSTLQSLDTCILCEPGTYQDQSGQTGCKPCVDAYQPIAGQYSCITYNT
CGAGTKFKAGSATADRTCEACEAGKFRASPSHKYTTCLSCPPGTFQPKSGQSGCLSCFEC
TIGYAEDTPCTPSTDRTCTDKDPPAIVLRRPDNNAVITNTYVVEATFAFEPPIFTATDAA
AGAVTKTLPPNIDDIDTSTVRSDQMLTYKATDANMNTATRTITVVVVDTTGPAITFDPAV
LQLEAGEEVMRSNFTVGVSIVDRVDGTLGINLLEYDDSDVNVNTLGMYEVVYTLSAPDSN
NNEAPPTTRTAAVVDTLAPVITIGFGDRDVSEHNVVIHEAATEFIFPSQSAFDTFDTAVN
GGDVRRNEEPTFSSVVDDGTQFTFTYTATDASDNTATVVYVIEVRDTMAPTITINGEHNI
THEAGTEYVDAGATATDLLEDAIGRGVEVVVTNNVLSKPPSAPAVFTVEYDACDKADNCR
LAIRTVHVLDRTAPVVTLYGAEEVHVPYATRYVEAGYSAQDVHDGNVTSQVVVSGADVID
VHVAGTYEIEYAVMDASGNTGVAVRTVVVEALMRPEQEDVVVELVLAGMPETIFGGVLQL
ERDLEEALNVEIVVVFNVKDGGMRKTAPGVSTSATVVEFGVRASDTLQWRDAKVFADDLA
QQVAFVGDVRVLGASVAGSMSSSSSPSRGGSVAGPAAGGVAGLLLLVVVAAVVLRCRSRT
AKSRLAAPGAEGAVTMNPTFEGGQVEPEEHVYQVPARLLATMPGSAKNTRRHTRWDPSFY
DVGKSETQQQQQQQQQQQKPPPQHQPQPQQPLQPQRKQRKQHDGAENVRGTGERDEDNGN
RTRPQSIHAWSSDLYDTHEGSEHALTFRVAVPTHSSTLASNASRDIRDAPVYDVVEVVHS
RR
Download sequence
Identical sequences PTSG_02374T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]