SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_02915T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_02915T0
Domain Number 1 Region: 5939-6061
Classification Level Classification E-value
Superfamily Cadherin-like 6e-29
Family Cadherin 0.00099
Further Details:      
 
Domain Number 2 Region: 3733-3837
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-28
Family Cadherin 0.00098
Further Details:      
 
Domain Number 3 Region: 1546-1670
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-26
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 1123-1224
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-21
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 1333-1445
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-21
Family Cadherin 0.00056
Further Details:      
 
Domain Number 6 Region: 4057-4176
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 7 Region: 1226-1340
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 1825-1930
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 9 Region: 3943-4060
Classification Level Classification E-value
Superfamily Cadherin-like 2e-20
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 589-702
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-20
Family Cadherin 0.0032
Further Details:      
 
Domain Number 11 Region: 475-584
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-20
Family Cadherin 0.00079
Further Details:      
 
Domain Number 12 Region: 1446-1548
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 13 Region: 3833-3946
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-19
Family Cadherin 0.0015
Further Details:      
 
Domain Number 14 Region: 271-382
Classification Level Classification E-value
Superfamily Cadherin-like 7e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 15 Region: 5842-5951
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 16 Region: 169-275
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-18
Family Cadherin 0.00047
Further Details:      
 
Domain Number 17 Region: 3399-3514
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-17
Family Cadherin 0.0012
Further Details:      
 
Domain Number 18 Region: 3515-3620
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-17
Family Cadherin 0.0011
Further Details:      
 
Domain Number 19 Region: 1032-1129
Classification Level Classification E-value
Superfamily Cadherin-like 5e-17
Family Cadherin 0.0011
Further Details:      
 
Domain Number 20 Region: 803-921
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-16
Family Cadherin 0.0016
Further Details:      
 
Domain Number 21 Region: 692-815
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-16
Family Cadherin 0.0039
Further Details:      
 
Domain Number 22 Region: 4169-4267
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 370-478
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000111
Family Cadherin 0.0021
Further Details:      
 
Domain Number 24 Region: 914-1020
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000013
Family Cadherin 0.0019
Further Details:      
 
Domain Number 25 Region: 6048-6157
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000728
Family Cadherin 0.0019
Further Details:      
 
Domain Number 26 Region: 1657-1752
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000457
Family Cadherin 0.0032
Further Details:      
 
Domain Number 27 Region: 6982-7083
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000128
Family Cadherin 0.01
Further Details:      
 
Domain Number 28 Region: 3614-3712
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.0018
Further Details:      
 
Domain Number 29 Region: 5308-5419
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000000445
Family Cellulose-binding domain family III 0.037
Further Details:      
 
Domain Number 30 Region: 5782-5848
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000286
Family Cadherin 0.0063
Further Details:      
 
Domain Number 31 Region: 6842-6947
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000343
Family Cadherin 0.0055
Further Details:      
 
Weak hits

Sequence:  PTSG_02915T0
Domain Number - Region: 2972-3076
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000191
Family Cellulose-binding domain family III 0.018
Further Details:      
 
Domain Number - Region: 3147-3215
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000491
Family Type I dockerin domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_02915T0
Sequence length 7519
Comment | PTSG_02915 | Salpingoeca rosetta FAT3 protein (7520 aa)
Sequence
MTTASSALVPACTRSTEQQLWHRHRHQHQQCRQWKNRAHTDNDNTMTVIIGVVVVVPGRS
RLPGQISCPYLVNVEEEQEPGALVYEAFGSSLYFFVSGFTNNDYEIVSHDNAGGILEIPD
PNSGKVYTRLKLDAEQLRPSPDREPVFYMYIGSTTSFIACQTVVAITDINDNGPLFSQAS
YPAQVREDAPPGTSIVNVSISDADGPVYRDYDTFIIGGNEEGLFELKSDTELILSQTATL
DYDTPPTTYTIMLEAVDRQDNSLRSNATVVITLLDVNDNPPVFDQDSYSFNVSEAATVGQ
TLFQLAPTDIDTVPVTSFAIVNHSEDVFQVANDGTVSLKAALDAETPPTSYTFVLQAFDG
PFTTNTTVTVHVTDANDERPTYDGPTTRSIEVPEDLAYDTTIFKWNVTDADVSAQNSNIV
FSTQTAGAPLDVDQTGRVHVVGVLDRESQSTVSVTFVASDTGTPPLSTQITLVLTLRDVN
DNRPKFASKAYEAELSELKQPGYEIIQVSATDADLGSNAVVHYALRPLDGATSESLFTID
DTGLVVLNGTLNSTLVPQHHVELLAYDEGTPPLMGTANLTISVLKGVPNKDAPTFTASPY
IFQVEENAASGTAVGTVLAIDMDEGALVTYRIRDPLSVPFAINAATGAITTRQSFDAETT
TVHVFVVNATDNHPDIPRSSEVAVYVNITNVDDLPPFFTQPRWAMTVPENATVGTAIVTF
TITDADIEQGSVDNIFSITGGNPGPASEKAFAVNAITGVFSINAPLDYEATNFPYPGTHY
YEVSVIVFPLRDFFEQDSAVVTVTITDINDNPPVFAETAYETTVLDGGSFSVPVNVSDAD
SGDNAVVSLSIHNTTAPSAFGLDGNGNLVSLVALDAEQYSATETIVIRATDGGSPSLSSE
GADLVVTVHIQDLNDETPVINNVDVYEVLESAGAGHVAARVFASDADVTAPSNVLTYTIT
PATNVNGLFSINGTGHVVVMKAELDYESVTSYTLEVVVSDNGVNPGAFNVTTTVLVNITD
INETPAFDPFVLFNATISEATPVSSTILNISATDPDIHPMFATLTYSILESSMPFSINPS
TGVITLATSIDYELVQEYTYTVQVSDGGFNITHPVYVWITDENDNAPLFAQPLHIRRVSE
YMAPHTSIVTFNVSDADSGDNGNYTLSIVGGNEAGGFVIEGMSLVSSLPLDYERTTSYNI
TVMAIDHGVPPMNSTARVDVIVLDENDNYPQLLHPPVTRTIRENTLGGTIIAQINATDAD
SGSFGRLTFTLIDPLTSDLGTPFHLDATTGILTTMDQTALDFEVVRSFTLDVNVTDGGGL
SNFTQVTVNLVDVNDNTPTFVAPFAELSVDEHTPEGTVVATYNTTDADEPNTPNSLVTYS
IQSGNSGPGGHVLLDINNATGELYIANATGFDYEQLHELTLVIVARDHGTPSRMQMATTT
ININDINDNRPIFSQDTYYVDIFENKTANSLLAQIEVTDADSGNNSDVSVVIAGGDVSPR
KFKLTTDLRFELQRTIDREQYSSFNVTLVAEDNGSPPLSSVAHVIVTVFGVNEFPPVFEK
DLYTAQVYENDLLNIAFVQVNATDQDRGNPAQHTVTYSIVGSSPFLIEPTQGLLLTADVL
DRETLTVPQYNVYVRASDSGHPQLSSTTRVLVQVGDMNDETPQFTKSTAYGFGFTETRDP
VTDNVLVGSAFDLDAGENARLTFSVLDGPDSDRFNIDPDTGVVTTNGQFCTDNVDTVTFG
VRVTDNPNGTVSECSDRCHLLFLSTGESFDGCKQGCVHGNTSSTLAQCETLCTSSICRQG
CRYFNGYRRSADASVLVTILDDNVYTPQFSQDSYFQFVPEDSVVGTVVVRFNATDQDSCN
QGFRFYFQGGASTTPDGAFSLDETTGELRVNGQLSRETQTLYELAVWVQDEGSLLNAKSS
SVMLTIFVTDPMPISFSTTAVGYPMGSTALVGTLEFDEKLTLFNNAAVGSSGSVRAYLGS
ALTSNSVSYSTQRRSATQVSATLAFTELYADGDRTVKAVLQVWDELWSSRVELNTYVKIV
VVPTSELASAAGASNLVGSCKVGTATGMCTASVTVPASWFSDTVVSGDQVVQVQYGFSDE
RTGLTSAGDVTLRYQPTFGITASSSPTNNDVQVQMPLRPVFVGETFEAVVYGDATLPVTA
FTLQFDVSSDLEILSINFDSGTWRAAPLVTDGGLSAGLSANHDNEAGLPTVEVAAQELVR
VAMRARSSAALDTTHSLTVQIKFLRNLNEPIVLSPVPGRVVDRLGEHEGTGTVYVASNPV
TAVFSYLAQAELVNTAVLDGSTQTVTLTTKQLNRQGALSTLSSGLSCSSDDTSVVAVGSS
CNRLELRAATTTQGSGLVAVTVQHVSSGEQAVVRARVWAPELPISLGLNDAQLSPVYGWM
TSGTCAQEYQRGRVKAVATYRYSPSGPAKQVVVNDVVDGHLSVSDGGVASVDGLMVRGVG
AGVANVTLNAGGRLAGFVEVAVGGGFVNASYVRGLALTSAELTLSSTSFSTDSEQTARLT
LLQELDVEEEEADVFAAVTFSDGASLEVTPAMGLSLTSKARSTVVVTDTNKVAAFGNGAG
DLVRLQWEPSTGCGFGVLAQGTAFVNVSLVDPDSVSMTVANAKVTYPSAPGLPSPFADTN
VFPTSTAVTVELVYGSTRLDRSNDNRTVYDLSQSNGLFTIDRSGPVPLVVANTAGLTGTG
VLGVSFTHVGVTATVSVQVVGVSTATLVPRPYPSYAGSASDIADELNALSGTGEYQEAEL
ELKLVGTDGVTRDVSPSGSTSYSIVGGVGLALSGRRVARDGASTSGSVVISAVHAGLEAD
NTVTVTLTSTPVLVSAILNENRQTGRVSFVGTLSGQSGTSSAFVRLGVEFDDGTRYESVF
DSSGNRQFDNLVTFSLDNTAVASVDSTTGEVTLLANHHETVTVTATAVDAGGVSGSTAFA
CNLAPAIGDVDLGSKTGVPVAPATGSGTRNVNVYVNTGSLVLGGVDLEVYYDASIVEPVD
VVPGATWPGGTFVKTLNDPVGTILLGGVTEDGIASTSYHLATIQFQVVGTGVIELYGVTK
KMGTTLANDGSVTDIGSPAASGTSPRAFISGDLRTDTARRRRSSSGGLAGYDASESARVR
RASDVVTTKCSATAPCTEAQCGGRRQSGDTNGDCIFDLDDIAFLQVYLTEEIFGFSTVRG
GNIKAALQDFQLDAMDVDLNGVIDPTDTSVLARINFRQLRFVRNVSVTTVAEDTDGCQLT
VIAEVLKAGDTADTNGQTEVYFDFAATSAQGGSAFQAAFDASTAAVGEVVVTNKGSGHFG
GIVKAASIGGGLYQVSLYTPIELSGIGLSPIQKTLDGELNTLPARTLAVFGSPLPPYDYG
SALSLAFDDVTISLSGGYSPNMKFDNTRGTGTCFNFFSPVFAPASLTVPVSETAEVGMVV
VDVNATDQDLGYVPGSEYGGIAVAAASGTLEYRLVSDNSSGLFSINATSGEIVLEGALDY
ERNTSYRLVVEASDQGVSTQRSATSVVDIVVVNVNDIPVFFAMPVFTGSVAENSAAGAFI
VQLSVDDIDSTSFTYALSGNGSEHFSVDPSTGVVTTSSLPTDRESVPSYNLTATVTDGTF
NATAFVVITITDENDNLPFFVSAASAEVPENAPMGSVVYTFETDDADTDVYSEVTFRLLS
VFATPVGGSVPVAAPDALALNTTSGELLNAMTFDRTVVNNYLITVSARNVVPVDGVSEQE
ITFTLTLSISDANDNAPVFVRDTVVISVPELTPVGQVLTQLIASDADTGVGGEVRYSITG
GNEEGRFSIDAMLGTISIQQPLDYETTMSYALTVTATDLGIPVPLSSTASVMISVMDDND
NAPQFTPDGYEALLPDTLAVGSVVAVVNVSDADSGVRGTVELTLANNPDNRFNISQNGTI
VLAQPFVPLQGEWAVLNISVRGQDLAASPLHSFASVIVTVYDVNTHAPVFEHLPQPLNIT
ENLPAGALVSFIPVTDADVDFNAAILFEIVAGNSESIFTIDPVTGALNTTRPLDREDVDS
YTITLRASDSSPLYTPRYNTTLGRSASPLSTDLTVNIAVVDANDHTPVFQNTDHEFSLVE
RQVAVLTTVSATDGDIGDNARITFSLANFSDPSVANKFSVNATTGVVRVAEPLDHDAGPA
LITFDVVASDHGTPPRSARFAMQLQVLDVNDNAPALVADFEPHISSLLPVGSIVANVTAN
DADSGENARVTFSIVDEVVAQIFDIDPDTGVIRTSVVLEGRGSLFSILVQGTDHGTPPRT
GFTVITLSTVSTMGLKPDVAVTGMGFAEIETEIVDTSPIRGVFEHSLTAFVPMDTTREGD
LSVAFGEQLTSSVTYSRPRQAAVTRVGAVQDTEVWASSRRIRVAAQVRDSTFNVRVSGAT
VRVRVVPDATLAGISNTEVTGSCTVSSSTSTGMCTVTADNLPLAWFTDSSLLALTEDPSV
EVFVYLNGESTAEHTSLGTVRVRRQREFSDVSQGLRMSIPSGTAFRGDRVTATVSGHAGF
QTDTFLMQVTTGSGLRIRSVTAVNTDKFSLQTTATTDQDWTVFGQLQDASTASSQPVSAE
DLVRIEFDVLSTATLDAVQRIDGVVEELTNVRGEDLFPTGNGAMEFEDRLTRVSSAPASF
GGIYVAEDAVVGLFAHVAESELVNTAVLTGDTVSRSISVRGLYRSGSVGTLSTGSLSGCS
VSDTEAVVLGAGCSSVDLTSAVGGRSPQVDVTVEYGGGALSFVFSVRVWAPRLPVTVTVE
DAELNAVQDWLDPNNACAQRYQRSFITATAAFAYDAQSDVEVRVDSLVSALFSSSNATVM
TVADGMVEGAAPGQALLEIVRPDAQVVGSTPVTVSSDPVTVSRLMPNVVTSLELSAPGTI
SVGANLLATASLQQEFALEGDSGVIYAAAEFTDFAVMPLRFDDADVLLRTESLNTGSVRV
QGANVVAFGSGSGDLVSVRWLTTCNNETVIASATAAVTVTIPAPDAADITVGTTTLTDAG
SVAASAGVATSTRLEVDLIYGQDAQDRTNDSRTVYDITPAGLVTLEVNTDGSRQVVPVAG
QSGTATISVSFTHANITASVDVTVVQVQDVTVSASPFPTYAGSTSRAVTELRPIGLTGEY
QQARLNLVLTLTDGSTRDVSSSGLTMFSVLSGGSVISVSGRIASRAGSATTGSAVVGATF
AGASSTSNLGLSLGTTPVFVSAVLNSARVSGRVNFVSTLSGVAGVGTSDVSVGVRFDDGT
EYPNVVSGGVVAVPNLLSFSVDNTDAASVDSSTGRVTVLQNDPEAVTIVATAQPDVGVSG
SATFFCNLAPAAEDVDLGATSGPAVSAVSAGAEFDVDVRVNTGTTQLGSIDLTVLYDATK
LQAVSVVAGSDWPSSSQLVPTLDDPPGEVLFGGALEGNGISGLNTIAVIRFRVLNTVSGG
EALMLSGRVTTMADLDGVLIGSEGRSFVAGTFDFLVSGGARRRRSSSSSRKLGGAESGLS
ATSWMAGERRVRRATCDSPPCDDSQCLSLTGRARETGDADGNCIFDVRDVRFTIQYIVYA
ATGFSNAEGMAFEAALLADGTQEAQMDADLNGVIDGRDSSYLAKVNFRQLRFVSDVEVLD
VTDAEANCSLTIRARLRAKGDVAADAAQTLLYFDIAHENVASQGLFLSSEFERGEAAPFT
VESGVRASYLGGYWRAELVDGSDGVFEVRVRTELVLADLGLSLVLVTTDVNGVTNVARQF
FLDGSSVPPYKFSGLLDVSVGALGAGLYRGSGYNPFTTFDISMRSDLCDLFDVGIELSVA
EDFALNVGFGAVFDGATSVPVLNYDLFGSGNTLFTVDPTTAQFQLAAPLDRETRDRYDLA
MRVSSSTFDRIVNVTIFVLDANDNAPVFNSASYVFTADEESVVASLGFVAATDRDIGPNA
VLRYSSNDTRLAVDAVTGELSLPSGLDREQSASYSFTVTVTDQPVDAGAALSASVAVTVQ
LTDINDNAPSFGAASITFSVAENGTGSDLVGVLTVTDADAGVNAQLQTLAIVTTQSDFTL
NPTTGELRTQRVLDRETQDEYQIVVVAADAGTPSLSSTVTVTIEVEDINDNRPLFTRSSY
RGAVDPGTDAGATVVYIGAEDADIGVNAQLTFSIAFGPVSSLFTLQRLTTDTNLRALVLA
QPATSLPAGQSEVEIVVQDAGTTRLTSRTVVQVLLADTQRASFSTLGAAPFDAAGQTLLS
SDDGLQQFALGVGPLYSTSIGDSFEVVAGLGNFTRTESVSVEASAPAQLELLVVDERVYQ
DVLEHGGHRTLRIAARVLDSENRVHTQPATVEVRFTPSGSLTLSKTASCTANSAAPFNGI
CMLSITVPEAWFLTTSTRQVTASGSVKGTGGAVAAQTTALLVPSNVNINTDVLAEDLWIV
LPARGLYENEQFEIGVYARSESGIGAFTASVTLGNELRILSVDMNEAFNADTPSINPVCA
SRTISGGAPCEEAVQVIGTDGTASTTTQLLFTITALVRTNMQASTTEVSASVSLLLGIDS
SRVRAAGVGSSVDRSGPHVQEAGVIHLLPSDHAVGLFAGSSRASLLNLAALGGSSQAATI
ETYAVRSNPSVTSVVDVSTSVSCTSTSPALVLTGCSASADPNAAAGEQGAVVDVSYDSLS
AEALLDVWHPTGPASISATTTTLFAIAGAACPGDPAVFEPSTLLVEASFSRGTAQDTFGA
DVTELLADALVLGDSSVIALEGSKLRALQPGTTTLALPTVGGSAVSNTLTLTVNSAEIDV
FSLVVLPFSRMSLTVTPASAGISNVLTAALTVEEAVSREGDALLVVTEAILGDGNRVAIT
GEMGLTLSSANESVLVPASPFSLTAVAAGSGELVRAQWANPCTGDVIASGVAYVDLQFNL
GVPAFDSSEYLIKVMEEQETDVLLGQLSATDPDTEREDPVYYAVVSARGLLASSGAVGGV
LPLDGFSMNATSGELMFLGSSGAVRLDREAMYGVELVVATSNYASDLEALTAAVAATPMS
VAELSNSSAWNNVGFATVELALLDTNDNAPAFVDTSLYSRLLPFNVTVEVLPFVNATDPD
LGTFSEVTFSQNATALFAVDDTTGRVTTATNPWSHPPESVVRLTATDGGGLSSNAHLHVE
VYDRLQLATIDFDQASLAEIQANLDLVAARLASHLGLKDAGIFLDPEGVLVVETDTLTNA
DVTLNFDGVSSVPVRARRATETVVRVHVISTVPEYMGVNNSDLAAMVVPPAVPLSDLYGP
YDAKALASRFGKSDALTQVLGFSVLRSGTFEDNTNGATPSRSSSTDSTLVVSVVVPVIAV
LLIIALLVRHRRQSKERELELRDIMHRKGLDLDDEIRVHGGADAPVTFSFSGGEVDNETG
NRFFYKTTEELKTVNAPLMGARSDGRMSELGFSQTTTKVITAERHWLYKPDPDEEDDGGA
ALMMQPQQDLGFSGDLLGDEAAGATDNDTWGSGQVTSDNPLHEPTGGVFSNPLYDSSAEA
ETSFGEEPAAESVKPVREAGFKTVAATQPSPVYRRRRTQHTDEYHAKQNPPRCDCAPDEY
SAEAMDDALLKEFRNYLMQ
Download sequence
Identical sequences PTSG_02915T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]