SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03008T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03008T0
Domain Number 1 Region: 1136-1454
Classification Level Classification E-value
Superfamily NHL repeat 2.2e-33
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 823-891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000459
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 3 Region: 273-338
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000195
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 4 Region: 463-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000391
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 5 Region: 347-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 6 Region: 543-585
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000118
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 7 Region: 397-466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000681
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Weak hits

Sequence:  PTSG_03008T0
Domain Number - Region: 576-641
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000588
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_03008T0
Sequence length 1456
Comment | PTSG_03008 | Salpingoeca rosetta NHL repeat protein (1457 aa)
Sequence
MMQQPSQLQLAAWCEVALLCCLALATVLVQGTSDTSTSACNDGAGLTSLASVFSENDLDR
SFNFHCQTIGTGTTTGVSVSGPYDAQLFRRDTSFRCPDNHYLSSVESQYSPTYVDRLFRF
RCHRPASAILRDCRETDALNKEAQSIMFEAGDSRVIAGMLSQPTNYDRIYKFITCKVECD
VSNNFVLTSNGLECTRLRPSVIQASVAVNEYKGAFFATCPEGQGIHLLSSDFSSSDADRP
SFTCYLWAAFRYIAGLSSSFDEATQDRVWAVTACQVSCADDFVPDGDDCTPTPCPELTFE
NGQVSGDCHGRVGQQSRTCQSDGTWSGSVPRCIPVFCPQLAIQYGKLTGSCSGNFGDVCF
MDGCESGYMLTGNTAVAHCGYDGWTADLPTCQPATCPPIAILNGQTDGCDGDVGGVCTLS
CNHGFILSDGSESATLRCRQEYDSGPASWVGPTHVDCIRASCDPLTLENGSVSGDCDGSL
GGVCRYESCDNGYRLSASGTRERLCQLNGVCTVPHWWTRMECKMELAPMLQVVLPGDTCS
LSSCDSGYWQSDAGAFEVTCVAQGDTAVWDGQLKSCERVSCTPLVLNYGSTLGQCAGNIG
DVCYFGTCYGDHFLTPGDPSRQCVQNEDSAYWSGDARTCQATLRGRAGQDFTLQCPDGQG
FVSVKSESSGYNADKRIMKFGCADVGSNDANRVWKSYRVDKPLQTFDFTCPDNYYLYGVE
TEYIPFSAPSPPRDVSDRVWTFNCAILHGAELSDCQTSQHYAADDYTFDFAAPNDHVLVG
FYSEYHTGDIYSRSFIFRTCKVTCNVGEQYESTAGPGCQRIGCGPLTLDDGTVSGECDGH
IGDECEYVQCDSGYKLSASGSDTRKCTMTKNGKPTWSGKPKTCEVMTTTTPEPNVVDLCD
AYVTAANPATCHARCEYYNKGAGTFTKQYGNCNNVCACGCGRRFRLTRDEEACTAHCDAQ
ELQGIFREMHLGCRQVCLCVEGGVTSTTSPGGVTGQPSPGAAFDFPFADYHYELTFTGNV
NGATSNARQFSTAVDAYAIIVNMEAESVLQCLRYCDAEQACLGVVIAPSDEGAFRCQLMR
DLGTDTGEPTSEPSVSLTKGTRPPAVSTTTPASEGVVQTVAGDGSTTWSAGGAPTTTGLN
RPVCVTFDGEHEMLVTMVSDHRVIRVDLRTRTSSLVAGTGEMGASGVGGAATSAQLNRPR
CAIADVEGNVYITEEGNHRVSIVDVASKKLIVGAGTGNPGHRGMGGTPGNAAIHSPVGLA
WADDGSLLFSDEENHVVYMVNRRSLIISVVAGTPRFAGYSGDDGLSIGARLNRPRGIALS
KGVLYIADSGNHRIRAVDMRTQVITTVAGTGSAGFSGDGGLPTNAALRVPHGVAVHSSGT
LAIADSGNHRVRVFNIGSSTAGVIETITGDGEHGYNGDNAATASSLNFPTSVTFSARTGN
VVFADTRNNRIRQVWQ
Download sequence
Identical sequences PTSG_03008T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]