SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_03424T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_03424T0
Domain Number 1 Region: 536-638
Classification Level Classification E-value
Superfamily PH domain-like 0.000000492
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_03424T0
Sequence length 640
Comment | PTSG_03424 | Salpingoeca rosetta predicted protein (641 aa)
Sequence
MAFRPLDVFLATAAAKPYPSSVASKPQPQPKSSAPVFSHPPPPYPGPASQRKSDVFSSAA
ALVRAATPELEPAFDMSDHEDAGMKHAAATSSAYPLNANDSGICVHHVKDCDPSHVDSHK
TCSSSSASSPCSDSDTQDMGSPTPPRTKRTPFEADVEALSDMLLHLQSSPPRSTVPETPR
SEIDEEEEADMELYATLLDVQSSQLVRRMNNSSSSSIGSSSSNHHHNDTPDRPSSPLASP
ARANPATSPSRVARRTASPHHHHHHHKPDAGKSTGSINNGNTNSPSHQQPAAASTTMPLT
VHDSAYNHHHHHHHQQVHQHQHQQHHHRHRHRRRSPKGSTSSGGGGSSSSSGDDGTGQRE
REARRQAHKKLKKEKRAKEKRRSKAHHDMLTMPLPADPREQHMVEMTARQQRNARHQSRL
FVSPTPRHSPHHHHRQHHRQDARVHGGRKSGGGRAHKHLSVNTLVASCDPGLCHPVMPVT
HPTTVHVMQPRDRRHSHPTDSSAAPVMMTRMTAAQQPPTVRAVTAVRPPHATSSSSSSSS
RYHSFVVLVTPTSTTNALGLNGTFIAQCREHNLVLLTPHSHNLVWEVKYNEIKRFSVERT
LHTLSLEVGRVHKSYFGLYCFKTQQYDAFFQTLHRFIDAK
Download sequence
Identical sequences F2U558
PTSG_03424T0 XP_004996010.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]