SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04246T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04246T0
Domain Number 1 Region: 1014-1297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-76
Family Protein kinases, catalytic subunit 0.000000608
Further Details:      
 
Domain Number 2 Region: 646-809
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.48e-30
Family Growth factor receptor domain 0.00024
Further Details:      
 
Domain Number 3 Region: 484-603,640-661
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000113
Family L domain 0.0028
Further Details:      
 
Domain Number 4 Region: 122-208
Classification Level Classification E-value
Superfamily L domain-like 0.000000000034
Family L domain 0.0072
Further Details:      
 
Domain Number 5 Region: 297-456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000127
Family Growth factor receptor domain 0.00069
Further Details:      
 
Weak hits

Sequence:  PTSG_04246T0
Domain Number - Region: 916-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.006
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_04246T0
Sequence length 1395
Comment | PTSG_04246 | Salpingoeca rosetta dominant-negative kinase-deficient Brutons tyrosine kinase isoform 3 (1396 aa)
Sequence
MYELLDCTVLVLAQYTQANRDRVFSAHATDRAVFKLASRVLQVANEASLDTEALRAYLRA
LKESFTGEQQAEASQAGPVHEQQRTDAQEVPRALVCALALLLCTSVGWDRSTLTVNFKTL
PSVLESLSNVTVFDGSISILNTVCNTYSYAQLTSFFGNIREIRGFLSVALSDAPSWDCVS
DLGFFANLRVIRGLTAYTDTATDVALYINPADMAPSHLGLSRLQMVGKYGINIQGLRPNS
AIMCGKGRVDDAGFEGVNLTALLPGTASRVGTSPVKFEVTNGDDVATVEYNQDPPANGDF
CPSPFCHASCNGVCWGPDAGDCQVVCSQDCGTAGCFDTSPGTCCPAECFGGCTDDNGVTL
CHACADGYLITSNGTCVLDMGNSSCPTGSYPAGLFIEQVEGCDDDRAITRTVSHFYCNDN
CEANQHDPLALEDGVCVDVCASGREPNATTNECIPLAEGEIAYKPCRSVFNVVDRCTLRY
LEDEDCDTLLGSIIAVKDSSPNALAYATEAELQVLSRIRRILGSVQLTFAPFTSLNVLRS
VEYIEARDGARPSGVDFGLVLVLSPLLRTAPLASLRYVPSVSFSGNPNLCFYYSTIDWEE
LGVTSVSPDPVPAATFGFTFNPLSYTDDFVTTHDSFPKEHPACDSTCHPLCRPDRCWGPD
IDDCQRCPNNTLLHEGACLAVGETCPDGFYSNTWSCRPCHSDCAACTGPTASECAACEGA
LYLKDSRCVPGCGDNFFANATTNACESCHTQCMQCFGPASDECAECVAGFSLRPWNNTCT
PVGTCPTGYFSDTATKTCTACPSNCIACTANTANAVPPILCLQADDGYYVTGGQVFAVDT
CMPGMEYEQMAPTPTSNRACAPITQCVVGREYIYENATSVSDQVCANCTECDPVTQVRRQ
GAGSCDGVVDSVCDFINVCLLDGCMNGGNCTSYNGTTRVCSCTSGFCGDSCQFVMGSDGV
CGATTAQSSTEQLFTAVGGAAGGLVLLVVLVVVTLRVRERIYGEIYKPDDKFRAQHAPTD
AWEIERDLLTVGRVIGEGQFGKVSRGLLVKSRDPYDETPAQDVAVKQLKGNANGTQEEDE
FFKEMDLMKSLGRHRHVLSLVGVCTLDDPILLLTEFSEHGDLRSYLRSHRPSLTQPESIF
EEDKIDFGAQIASGMLFLADNKIVHRDLAARNILVSSGTVLKVSDFGLARDVAGEDMYEK
KSAGKIAFKWMAPECINDRIFTTMSDVWSFGITLWEIATLARPPYPEMNNYEVVQALKTG
YRMPPPDECSDDLYDIMRRCWVDSPERRPLFKDLLEELAGLAGKSTAAYLDDAAGEKPTK
LADGVIERLKEDPDRPYLIPTLQRDQLPELSKHQVDLATLAEEDEDDDGLGYVEGKVATN
FEEPEEQEVKETRLR
Download sequence
Identical sequences PTSG_04246T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]