SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_04890T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_04890T0
Domain Number 1 Region: 81-178
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-16
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_04890T0
Sequence length 179
Comment | PTSG_04890 | Salpingoeca rosetta predicted protein (180 aa)
Sequence
MRQAQESMPFADELDPKTQEKEKKKKKKKDKEALREEEARRQRQIKQQQRRAKLNERHQK
IRDKYGLEGGMPVITPCEEKPPKQEDLTGYLLKRGKVNTAFKKRWFQIEDGQLSYHKHSF
EAPCGFIRLSDIKRVRLLDKQSPPELLLETSARTFVLRSPSDSSSELQAWAAAIDLAIP
Download sequence
Identical sequences F2U8X4
XP_004994208.1.12839 PTSG_04890T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]