SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05491T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05491T0
Domain Number 1 Region: 1612-1873
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-69
Family Protein kinases, catalytic subunit 0.00000404
Further Details:      
 
Domain Number 2 Region: 2106-2188
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.31e-22
Family Cap-Gly domain 0.00048
Further Details:      
 
Domain Number 3 Region: 20-144
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000175
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 4 Region: 557-641
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000196
Family Cadherin 0.012
Further Details:      
 
Weak hits

Sequence:  PTSG_05491T0
Domain Number - Region: 330-385
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0753
Family TNF receptor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_05491T0
Sequence length 2190
Comment | PTSG_05491 | Salpingoeca rosetta tyrosine-protein kinase SRK2 (2191 aa)
Sequence
MVVCELKPIVPPPPVSVTKGNFQYYTTFEMVTYADARSVCHDWNEDAYLTRVESAAVEEL
LFDLMKTADDNNDWDLPPNPRMWIGLQRPGDRSSFKHDMNSRDYTSSDYKSLEYGDGDCG
TMSIESSPRWLRRSCSNNFLFVCRVTLYDCFAGTHYDASSSTQGCQECEGGKFTSETNEP
RCETWDDCDNQDNDRGTRLFLSPSFTSDRQCFDCTSDEERVEVANSYYACVCEPGRYRGE
SSFSSNVCVECAEGTFKKDPGDDECEVSEPCGYGLEEVAPVTPTSPRECRECVQDVTYFS
FDTNKCETVHPPCESPEEETQEPTKLQNRVCKECVQFETFYNSTTKKCQSVSSCPYGEEE
ITEPTLTSDRVCEPCILGETFYDGNSEQCEPVTSCPLGTVEYEEPTLLSNRKCRSDAFTC
EDGNRTSNGAACNCTDIADACSVCHRDLQLEPAYGLVGRMFNAQPTETRLISQLTLDASV
TDALAFCTDKCRVQYASEGCVGFTLTTGSMRQCLFVSWFENESVDTAGANFYTLPACDRC
AERYAIDNRGCTLTATPPVLSVADRRVLIPLSQPAGSLITTVAATTDAPAGQDDITYSLT
TPDGFADVFSINATTGVITLTKQLQTPAAPVLLVTARDSRTECNLLVDGTLVKNDGSCVS
ETMDITVSVVALLGCPRDINEYVVSQNEVEVSWGVTPSFPAYLTDLELVLLRNGNESDAT
VTTVMVPVGTTNFTYRSNETVAGEYIQCSFKVSVRKGFFIQVDDIDLRQSGNASIAYSLS
SPGIADASRLPTFESDLTSSFFIGFRTTTGRPFSLSLTEDLQADINVALRWCTDNEPFPT
SVPPTATNASVGVTFAGVTTNGPLPVFSDEGTWVYQTAQRSCVNLIASSQAVTTSMSFVT
MELQFNPLPVARRRRADPPTQLFIPAFPSYVAFELSRIDGEPATVEELAGALTTKDVIAP
TFLDCPPPLAARTFNIDTMGQVETLVELPKLTVYDAIDPAPVVDPATYSSVLSAVDSPHS
VTFTASDSSNNEAQCTFDVFVTVPENVLQRKEVVTEWAYPIERRIVPDLNLAFYTHRIHG
TGPVSSFQADMSMLTGLNMTFETKNDELPFVVRERAQAARGRFVVDMQWEAAGKTPGFIY
EHQESASAFLVVRGFKYSDDTAAPVTKKFALPEQLVAVRESDGVVGVVGRTDAFTRPFTF
TSATLVLRFLGVADDNLGNVTWTLTKDSHVGVEYEYSYNPNKGPLAASTVAGFLTLLDST
PPIFSFCPANISAPTNIGKNYLTASWPSPVATDNRNRTYLSSNFASGHRFPLRKPGTGPW
TVMYTATDAFGNTAPCTFTVTITDTERPVPSPSHTVYKTLPATASTVFVGIDELMPASVM
DNAMMTDQAGDPIPWTQPRLTEDNTPDNNRYGLGVHMVELWFTDAFNNTAPAYTFINVTD
VTAPERVTCPGSKGVSTPLDESAAIVNWTMPTFRDNSGVPPVVTSSHVSGSEFAIGKHTI
TVTAFDASGNEALIPCTFEITVFANVSAPPPPPFSNSTIGPFASRSQDTGVIAGAGAAGG
LLLIGVVMGIMFVNRIRARSRAPQNWEDIFKLMDQFKDCEEGPRYPRELDRAALKLLEEL
GKGAFGVVYKGLLKEHAHIPGYLVAVKSLHEKGTLADRQELLEEAAVMAQFVNPHVVELV
GVITVGKPVYVVTEFMEHGALKSYLEDNDVPVDKLVMWAGDCCEGLAHVHGKGFIHRDVA
ARNVLLSSEMRCKISDFGLAREIEEDDTYYKSRGGQLPVRWTAIEALEERKFNEKTDVWS
CGILLYEMWTRADLPYKGWSNQKVWVEVAAGHRLSKPDGCRDDVYERMLACWSESQDDRP
TFAQLSEFFRTLYKELTGEDLNAQDYLEVDATAETEPVEKKRGLKGLLRRLSGKHFSNPL
YKADADDGDDDGDNNNDNDDDPNAALYDMGEDEPTAPLPDERDENADLYDMGDDNNDNAF
TTTTSLGALPEEEEEEEDQNGAEGADLYDMGDDNETGGTEGADLYDMGDDEPQMAATSFR
PQQDLEGADLYDMGDDSAGTAPVKENISGFGFQETGFGMAAQQPPQQDFSQDLYGNMGND
DNEPATTTFGRTAGDVSAADVGKRVSVQGYACKGTLRFFGNHSVTRAVRCGVELDQPLGK
NNGTVKGHKYFSCKDKHGVLCHPGKVSVIE
Download sequence
Identical sequences F2UBD3
XP_004993362.1.12839 PTSG_05491T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]