SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_05933T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_05933T0
Domain Number 1 Region: 145-353
Classification Level Classification E-value
Superfamily YWTD domain 0.000000314
Family YWTD domain 0.024
Further Details:      
 
Weak hits

Sequence:  PTSG_05933T0
Domain Number - Region: 326-425
Classification Level Classification E-value
Superfamily NHL repeat 0.00204
Family NHL repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_05933T0
Sequence length 441
Comment | PTSG_05933 | Salpingoeca rosetta conserved hypothetical protein (442 aa)
Sequence
MASVLRAAPVLVPVLVLVLVAAACNRCNLQQHACPCMCAAEVVFAEDDAGALHINTSDPM
SQPVLVNGVNMGAVFDAVAAQQSMLQAYQSVMDTQQSRISMQQSRIAVQQDRIAALEAEV
CTPSTSVFGQLSGASNKWVGGALAGNGLIYAAPFNADSVLILNPTTNTADVTSIAGFTSG
GGKWAGAVLAENGLIYMFAASATSMLVVDPETNNVDVTSIHSLPSGALKWASGVVADNGL
IFAIPYAFPSVLIVDPATNITTTIALDGLSGSGTEWYGGVQAANGLIYCFPSAATFVLII
DPIALTADTTSIQGLEAGAYKWLGGVLARNGLVYGIPARAGTVLVIDPTTNSIDMIRIAN
STITSRWAGGALAANGNIVCIPYSSTPALIFNPATNATTMVAVPDVGEGPVGWWDGVLAP
NGRIYGLPLFPEVVLAIDPGC
Download sequence
Identical sequences F2UD74
PTSG_05933T0 XP_004992826.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]