SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06113T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06113T0
Domain Number 1 Region: 140-221
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000217
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06113T0
Sequence length 247
Comment | PTSG_06113 | Salpingoeca rosetta predicted protein (248 aa)
Sequence
MQQALDIFTSTLRPDHPHTLKAERNLRRIRGGAVTRQHTSTQHVSESRLQQQHVLAHRNL
LLRFISSAVVYQAFAPQRNLLMRFPGAVAHADVDARRPANTGSDGEDKKTGTGRDAPRGC
SAPARALYKDACECPSEPPAGWLRKRGRRRAAFRPCWCRLDDDGHLAYGKSASGTAKRRI
PLSSVLSAELAHGGEELHVAVSGRTFVFRLDARSDTSLADWSYFTPTSTPTTPALRISSS
RARPVEK
Download sequence
Identical sequences PTSG_06113T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]