SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06368T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06368T0
Domain Number 1 Region: 353-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000829
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 
Domain Number 2 Region: 270-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000978
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 207-257
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000832
Family Cadherin 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06368T0
Sequence length 439
Comment | PTSG_06368 | Salpingoeca rosetta predicted protein (439 aa)
Sequence
MGALAWSSTLMAVAALVCVASAAPMPPPPMLLVRTIVIEANTGSLVSSPHLGVAPPDGGA
LAQEGYEFRCLDCVLPDGIVFSPVSGRVFGLTDAIGNFTDISIGAATTGSPDNQFVPVLN
ISLIISPATDQGTIPFDETFDVLYLDQPFSFLSSVVVNDPTVGPFLPSSVLDDDDDEGGE
DDDDGGFSSRRRRAASNVTEVLIFFLDGDIPSGIQVDASTGIISGTPTQQADTRTLTLYA
VLGGTTIALVRINVTVTSDDCSVATNGPNGRACENGGTCVDGARGDAAFTCECLDGFQGP
NCGVSTDASSSGALSESSRIALGVGLTVAGIALIAVAVIGRKYFKDNKVKDASSIVFTPP
EPDVWEYPRDQLTLTGNLGKGQFGIVSSGEALNIRGQPGVTVVAVKQCDQAVDDPVLVVQ
QKKWFVAEGQVMKRFNHPN
Download sequence
Identical sequences PTSG_06368T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]