SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06436T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_06436T0
Domain Number - Region: 2234-2327
Classification Level Classification E-value
Superfamily Cadherin-like 0.000942
Family Cadherin 0.031
Further Details:      
 
Domain Number - Region: 2351-2424
Classification Level Classification E-value
Superfamily Cadherin-like 0.00298
Family Cadherin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06436T0
Sequence length 3259
Comment | PTSG_06436 | Salpingoeca rosetta predicted protein (3260 aa)
Sequence
MGVNDAPILDLDASSPGSGYKAVFVEEQGAVAAVSPTDLVLIDVDNATVSGAWARLWSAE
SASNADAQELVTDTSGTGLSWSYDSASRVLSVSGVGTTAEYATVLSRVQYNNMEDEPHPA
NRTVTFTVSDGLATSTPVNSTIRILLTNDPPRLYLNGSAIVPDTSIVYDEGEGLRQLFDN
VLVQEDDVGDLITQAVLEITNPQNGNLESMALLSFVGASVQLGPASLTLTKPDGVAAWIQ
ILETVAYTNDAKAPRGEVQRVITVRIKDLAGAWSNTASCFVTIIERNDSPVLTSTAFALA
DEFEDETDTTATPLAALIGPSITDADADTLAGIAVTGFDTDGGRWQLLVNNTLWVDIPVV
SPASALLLPLDDAVIRFVPLPDFNGVQTLSFRAWDQTEGEAYNYTDTTAAAASAFNAFSA
SVGTLSINVLPLNDRPLLNATRVAAFPDINEDVPVADNTGASLASLVVGAIDDIDAGAVP
GVAVVEADVSNGAWQFSLDGGSSWTTANVSSAQYLLLDASSAQTRLRFLPNLQFHGTTSL
TVQAWDQTDGEASGSYVNSTRADAPTSPFSLAHARLLLTVLPVNDQPVLNATAATAVSLT
PIMEDVPSAANTGDAVSSLLERVVVDFDADAVLGAVVTAVDDTNGIWEYRGMYASAWRAM
TPPSGSGLPLLLKGTARVRFRPGLNFHGNATFTFHAWDQSSNSTNVTSALGDMTAAISDA
SAMAAITVLPVNDAPTFTGVPLRLNSIFEDVPARNNLGTTIADIVDAGVMDVDEDTELGL
AVVDSRVEGGSWEYQVVPGGNWSTFFGTILINGARYPEYATERRAFSLNTTQVSIDVESV
NDITQLQLNATGNATNAFVTFVEGSDGTLVTEGVTLTDEDDTHLAWVELLLADIEDGTDE
TLTVHMVNSTANVTLTAVRMGINNDMLRLTLSGSGLSLDMAALLLESTTYSNAALEPVVG
ERVLTVSVSDGLNPVSAQTRINVVPINDNAPLISNVTTDLVYDENSGFVHVSPWLQLSDD
DHNDLFFMDKALLELEDPRTTEVLRVDAQSAAASLPGLQASFANGVLTLNGPLSVNDMQA
VLREVEYADEAEEPDPDARRIHLTVLDDDFISNEVVFELEMALINDQTPVVDLSGDAAAG
IDYDNVTFVEEGADVSVVDAQRLTVRDDDSGPFLMQWASATIVNGQDGSAEQLYVTATSP
NITSVVYTPANYTLELRGAAEASEYERVLRTLMYGNSADEPQPPTERNISVVVADDSHVS
AAAVSRVRIELTNDAPVIDLSGPSVPGRDVVAQYREGQGALSLVDSSAARISDDDDTELA
YVSVSIVPRPDAEAEVLAFDAGVLSGAGSGITVNATSAGVVLRGPASVGAFEAVLRTLTY
ENTMAKPGRPSTALRHVEVVAEDVRGGVSLQSTAFVSFMGVNDAPILDLDASSPGSGYEA
VFVEEQGAVAAVSPTDLVLIDVDNATVSGAWARLWSAESASNADAQELVTDTSGTGLSWS
YDSASRVLSVSGVGTTAEYATVLSRVQYNNMEDEPHPANRTVTFTVSDGLATSTPVNSTI
RILLTNDPPRLAASSNLRNVFEDAALAVFPDLVLEDDDSDSLSSAVFRILNPVDGVLERV
YLPADVAVPSGLELRDNDTNSMSVVGTAPLSTWQDVLSSVHYRSLSQQPYPAIREVTLQA
RDDMNATSNTVRANIGVSTQNDAPRHRSSYPYDETVSVLEDGVLVLPSLRYFHDPDDVLQ
PSGVVVTPSPHHGTAQVNMTNGDVVYTPDANYFGSDSFGFLVCDSKQACSPATIDVAVQP
VNDRPTAENLTVTGPEDTLFVIDLLSLVDDVEDAAELWRGLSIVSEPGRGRLVGWLAGDG
TSTTTSTAASTLSSTTMDGSGMDATMPPMSGDGGSGDTTTTATTTTTSTSTTATTTTTMT
TSSSSWSLDMGSGDTSSSSSSTTTTATTTTTGSGMSPPVFSTTTTTTTTAPGSTTAFAGS
VTPAPPTEPTLPDTLFEPTLGLVGYIPDAHYHGEDAFRFEVCDPEGLCSQAVISLVIESV
NDVPVAVSIALTTEEDMAVAVDVGPYVADVEDADTSLALTVTQPTSGTGIAAGNTITYQP
NAQFTGQDAFTYTVCDRDGACATANVSVFVHAINDRPRAANITGELLEDSSLTLNLVDLV
FDVEDQLDGMDVTITEDVQSGALTYDANSGIALYVPDENFNGWDGFTYRVCDTQGLCRVG
RVDLTVWAMNDVPVTSTATLTVREDEAHALALRPYVSDVEDNAADLQFTVAVAPLHGTAS
IDASTAVLTYTPASDYSGLDTVRYRVCDTEGACARGEVDITVTEVNDAPVASDVATTTPE
DTPLLLLARDYVVDVDDDVADLSVTVGAPTTEHGTLRVDTRTGIISYTPDDNFHGTDAFN
FTVCDLAGLCDTASVSVEVLSVNDAPTVADVQENVLAGTAIVLDVVSLAEDVDEEPPSDP
NHVLNPLSVRVTRQPENNLAFVEVVDGRAVVTYVAQETTSTYGFFGTETFEFEVCDKFQE
CARGTATITVDFEGPAVASVVASDPDDGDFTFSTGDEIVVTFSEATNMPFGTSLDEEDVA
QLLELPTALAFSGRFTGAWASPTELVLTVAQCLTCRGEETGLQFDTTPPAVSLIFMDQFA
GERIRVRAEGGLRNAAETSLPSTAVAPRFTGDWGRAQPQVTTIEVSSPTDVSPSEAGFAL
PTGTQLVLSFNGPVNRLACTELTAEDFDLVFLQQVLSRGDDDALTADLGSVVGRWVVAGS
DECPLTEDEAMQLGANGGAVTARRRRAANVPTYADSLMLYVVDASTQTLPSVSDLTLFLS
VDDTSLGTEFNNYLQSSSQTTRKVIDVMDPNFDPVTDASTTNEGVYVVTFVAADPDNRDS
EFSVGDTLTLTFNTAVVSRDVSTKRAIDEALVFEQEGVAVDIADYEGEFTAPDTLVITVL
NATSNIVPAVGGMRVRMLPETFVAANDESVVNVQSGRLLEGDFGSPRETSAMYYVAPVLL
FVIAGLFALFALFKQKRAEDKRKMSAAVLTSGQEQTWMQPPPAVTMRKTQDPFTNFDTLG
ASQHGSAAAAAASSTKPQEKRVSVPRLSFDANAHRSLPQPPSQQQFSPRRRPSLIARSGS
TSSQQQQQQQQQSNPLSPVAVPPLRRDSAGEGAVPRRSNMPKGSLPPLRTQDPFRAASGA
PHFLPPLAKRPGAGTTRPPSLSRPPPPAAGRLASLSRAPGQGGAKRPSLAAPPRPSLPSL
RRGPPTMRPPPGTRGDSKQ
Download sequence
Identical sequences PTSG_06436T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]