SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06479T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06479T0
Domain Number 1 Region: 293-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000128
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 2 Region: 333-445
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000251
Family Cadherin 0.012
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000174
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_06479T0
Domain Number - Region: 140-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 80-122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0649
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_06479T0
Sequence length 477
Comment | PTSG_06479 | Salpingoeca rosetta predicted protein (478 aa)
Sequence
MMLATTADTAHSFPAPYDGAVHVADSSTQSSTGVQTASNRTGTGFTGPQWQHLITCNVTQ
DTTPQFSAQLFPEPPDIIIAYDERAVFLCFSGFRSSASEDGPALVFRTCTASGRLGAPSA
TCVDTDECASVAQARRALSSLQQCINTNGSYACACTAPDSMLSSDNRTSTPNPCGPGTCT
DLVADFTCSCEGTGFQGDLTLTTLLPPDSTPAYMTSFTRTCRADQTYTNTELACRDVNEC
DPDAQDQPRTYQQQALYTCDDGYTTTGDAQAAATYTATCTATGNYTFQGTCVEVDECAAQ
PCMNGGMCTDLVNAFECACVGEWGGPTCSDDTNRPPERISLSTTRVPENTFPLPLVTVTV
EDPDTHQSHTLQVLSSTPPGVIVVATTNGGSSSGGAGAASPTLEITRALDFEVDGSAIEA
VVRATDNGTISQLSADFLVRINVEDNNDAPTAVLLDTTSIAENTPCIPHQHRGPRCW
Download sequence
Identical sequences PTSG_06479T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]