SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_06942T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_06942T0
Domain Number 1 Region: 66-228
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-33
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 2 Region: 518-679
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-30
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 3 Region: 765-908
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-23
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 317-431
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-22
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_06942T0
Sequence length 1417
Comment | PTSG_06942 | Salpingoeca rosetta lectoxin-Phi2 (1418 aa)
Sequence
MKLASMLAVLVVAALAASVSSTSTTATTTTTTTTTTPAISVPATTATMNTTTTTTTTTTT
AVVTPTVPVTESSTSTSSSTSTSSTSTSEFGVDNILDWTEFGNFEFRLIQQKRTQDEAQA
SCETEDGYLATILDPEEQTFLRQVVPKSTDLRQVWIGAEFDDLHQNITWQDGRTTSLSPL
PWADGEPNNFNDDQFCVVFSTGTVEDRDGTWIDMGCDSTRGYICKRNAFTSSTSTSTSSS
TSTSSSSSTSSSSTTSTSSSTSSSSSTSTSSSSSTSSTSSTSSSTSTSTSTSSSTSSSTT
STTTTTLFFALGENGALFEGNTYYFYDDKVQFDTALAACRDDNAELVSLLSNDEYRFFID
FLSVVTTNTQIWLGAQLSNDGLSLEWTDMSPTNFTDPLVGTTPLACVVQNQDNDQWEDLS
CTRRRSYVCKAPYITTVTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTST
STSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSSTTSTSTSTSTSTSTSSSSTSEF
LVDNLVEWTEFGNFEFRVIQDKQSQDDAQASCEAEDGYLATILDAEEQTFLRQIVPKTTD
LRQLWIGAEFNEAHDSIWWQDGRTTRLWPLPWEEGEPNNFDGDQFCVVFNTGTTDERDGT
WADLGCQSLRGFICKRNAFTTSSSTSTSTSTSTSSSTSTSSSSTTSTSSSTSSSTSTSTS
SSSSTSTSSSTSSSTSTTTSSSSSTSSSSSTSSSTSTTTSTSSSTSSSTSTSTSTSTLFR
TVEPGVAVFDGSLYQYVDEKVTFDEAWAYCVDEWDGSLVSVLSQAELDFVLVVIRASTTN
NQVWLGAHLTDDGASIEWVDGSEAVDFGWPLAASATTPGACLVQNTQNGEWEELPCTRRR
SYMCKREYVTTVTSTSTSTSTSTSTSTTSSTSTSTSTSTSTSTSTSTTSSTSSSTSSSTS
TSTSTSSSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSTSSSTSTSTSTSTS
TTSSTSTSTSTSTSTSSSSSTTTTTTPFVPPSVFNPSFEDNELSAGGFIAAADNWALSGQ
AGTFFPNNGEYNVPDQDQVLYLNAGASAWQLLQGVRLGDKVHVQVAVNVGWRADYDRFLQ
ADLDVYAEESQELVASAKVTEFFFTGLGPGDFAAVTVDVVDFGPELWGERLRLVITNTAD
RQQVGIDNISVDVSLDTTTGTSTSSSTSTSSSTSTSTSSSTSTTTEFVSVPLGNTGFESQ
VLANEGDFETVITDWVVSGVSGVFHPSAAEYADGAPEGNNVAFVNANSAISQVVSDVELI
TLAEVTMTFRVGWRQDQDRFLQMEAKVYAGEGDARMLISSRRVLETDVIRGEFVELSVVG
FVTAEHSAFNSVTVEFENTARRLQVNVDDVSLTIVNP
Download sequence
Identical sequences F2UF90
PTSG_06942T0 XP_004992343.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]