SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07207T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07207T0
Domain Number 1 Region: 96-197
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000356
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_07207T0
Sequence length 210
Comment | PTSG_07207 | Salpingoeca rosetta conserved hypothetical protein (211 aa)
Sequence
MADEEFEGFGFDEEEDHGFGDFGAEAEQMPEPETGASESVARQADAAPGEGAQAVSETPT
PSEATTTTSNGEAQAESATSSGDVLDSVGHGEDVRLERSGWLRVLEPRKTLSRRGGLKER
WFNLQDGVLKYSSSVTSKPISTIDVGKITSIVEHREQPEAFTLIMDKKSLDVIAREEADA
RSWVASLRKAQKSVSSTGNFGGSTGSALLF
Download sequence
Identical sequences F2UED2
XP_004992627.1.12839 PTSG_07207T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]