SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07734T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07734T0
Domain Number 1 Region: 1567-1657
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000102
Family SH2 domain 0.0018
Further Details:      
 
Domain Number 2 Region: 421-595
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000565
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 178-228
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000151
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number 4 Region: 763-833,876-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000351
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 5 Region: 638-681
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000706
Family TNF receptor-like 0.005
Further Details:      
 
Weak hits

Sequence:  PTSG_07734T0
Domain Number - Region: 890-1037
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000659
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 324-364
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00706
Family TNF receptor-like 0.01
Further Details:      
 
Domain Number - Region: 558-591
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0259
Family TNF receptor-like 0.0074
Further Details:      
 
Domain Number - Region: 1079-1137
Classification Level Classification E-value
Superfamily PKD domain 0.0432
Family PKD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07734T0
Sequence length 1681
Comment | PTSG_07734 | Salpingoeca rosetta hypothetical protein (1682 aa)
Sequence
MLAMAFSACGSGSRPSARLAVVLLGLLALAINVQPDDADREAAKSLGEISIDSRLPCDYD
PEDGRVGRVLLRLGALYYGFTATVKFREGEGGTVLDTAEVYLAGLNNNDPVPRTSFYMAT
KPQVYAGRTYSVSIDCSGYGCGAVYSTSNPYTEGMIRERSGQRYDDIDFRVDFVYDFCSD
PLYTPTGGSCTYLTVCPAGQYAATLATTTTDRVCGPCEDGTFTDAPNQAECSTPTPCTAS
QFQTAEPTIISDRQCQEASTCDPDTEYKTANHTATEDTACTALTVCGSSRYETVAATPTS
DRVCIDKTTCDPQFAYETHPGTATTDRECSPLTICAIGEYQSVSPTATTDRNCSTCLPET
YKTVTGPASCAPCLQCETDEYASVECTPSTARVCADCFGECSDGFHVNGECTSSGTRICE
PCLTADDCDTGYFLSGDCEPPSLQGPVCKKCHESCASCTDDAATSCLTCIPGYAYHNGVT
NLPTQDQTWLFVTDKATAAGRCVSNCPDDHFLDETAVCKPGTFISASCTAFEDAECSPCT
LDVTFSDMNNTRSCIAVSPCGIGEETAAAPTTSSDRACAPCEAETYQDMPEQEECKPVSV
CAQGEEFVSQAATTSTDVQCSPITACKAAEYQQQAPTYTSDRVCGRISVCDPGTYELKPP
TAVSDRVCVPCPADTYQDGPGATSCKPVRRCTASQFQLRNYTATADRVCSAISTCGAGEW
EFSVPTATSDRVCTDAVQYCAVYPPNTDQECVRCNPGYHLTAADTCTACSPGFTCDGLIT
TPCPRGHYQDKSAQTTCKPCPPGSITSGAGQPVCAACVGATYQPLPGKSSCNPMLTGHYG
VRNETFASLFTAFDVGYIAQEPCAAGSECVDGVDLLCVPGTYSTGGAAACSPCGPTGFSP
VSGSTSCFNISEGWYGDGPSANVFSMIQPCHTGHYCRGGVEHPCPRGTYQPLTTQGACTP
CGANAFNPNTGSASVAACRAIDGGFYGTGEDDAHPGQMPCPPGHQCVGGVRYACAAGTYQ
PLAAKTSCLQCDASCQLGEVVDTARVCDAVSGVAACIDVSPPTITLRGSPSVRVRVGQTF
DDPGATCFDTRDGTLASNRTTPLLAAVGTYTLTYMCVDAAGLEAETTRSVTVYDDVPPVV
VLRGGATIKIIQFDDYVEPGANVTDNADPNVKLESSGDVDASTPGTYTITFRAADTYGNE
ASPVVRTVIVLDIDTETTAQLAANDAYSTTLKSTGDRLLAERAARRAYLQNNGGQDLDVV
VQAAESHYTSQQSSSSDSTSAASTTIIAIGAAAGVVVIALIVVIFVIRSNSKHARVTNMS
MPYANPAFDAAGGYDNRTMMVNTAEFMKQQRGARAMPPPPDYQPSSSVYYSSVNEPDNTY
DYANPALSRAAASAGDTAVYGFADDTTGNTSTKASKGLPSNDASRADEGERYEAPVASFK
RKQSALPPSVDADPNLQVYGGSEALPDMAVYGEANTDSHDDDGDDDYAAVTDPDVTAKDT
GVDHAYDTIEQEGQAQSVATMLASTDATDTVPAAAVDMEDYTDTVTKEGDYDVALISQQE
YGRTQPLTKEVHEQVTKTMSTWFQPRLSRDEARALLSSRPIGTFVVRKSSRAGSYAISVK
AKENKIWNGLIDPCEEGYTFNNRSRVFSTVADVIVYCHDEAKAKKMGLPLGLVLPEGDYD
C
Download sequence
Identical sequences PTSG_07734T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]