SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07791T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07791T0
Domain Number 1 Region: 400-707
Classification Level Classification E-value
Superfamily DNase I-like 7.59e-48
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000068
Further Details:      
 
Domain Number 2 Region: 10-107
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-17
Family SH2 domain 0.001
Further Details:      
 
Domain Number 3 Region: 996-1049
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000123
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07791T0
Sequence length 1056
Comment | PTSG_07791 | Salpingoeca rosetta hypothetical protein (1057 aa)
Sequence
MEEIYGNVETLRHAWHYRNLTRQQAEELLCQQSCPGSYLVRESSSGSNTVLCVIDEAGLV
VHYLISRNEDGSVQFKDRDDRVYPDLEALIEHCTRKKRLRVLLTQPCELPVSAAGAGSMD
ARASGTASDATEDEDEDDDEEGDEEQDFNTVLERELRTAASQQARLRWPPSDAHLHKVFE
EYIHFNALGDAGDAHQEQTLAKFRALVAELGKPLLQELQTFQTRLDALRNVFQSASMQSN
IKPPIRIEHPDVKEGSDELTRLSTSLAFSKSLVNNVEAFATSYLKGLLCKHGSGGTAPAV
ELSAMRTFDVRRVDQMMKTSTVISVNLSEGFVSIGKDDPKPYKHDEILQLIKSRSNKQRL
GVVLSGKRKDFVFESLAEREEFCQLVQSMKNRLGDDKATDYIRNIDVFIGTFNMGDAVPK
DQDLSTWFRCDGTGTGGSMDPSTYDIVAVGTQESGGSERDWISTIKAVIGSEFYQVAFVR
LLAIRLVVFAKQAHQNLISHLQQGTVATGIANKLGNKGGVGISFFFEQTSLCFLNCHLAA
SANKVLRRKANIQDILGKLQLGQKKLVGFDVASQFHHIFWFGDLNYRLDYPREEVLDVIK
ANRIEDLLRRDQLRTAMHEKTILAGFDEGRITFKPTYRYKRGARNEYTIVKHKPGGVKKI
NVPSYCDRVLWRSFPDTRIRQLAYGCTTNIVTSDHSPVYSVFKIGVRSQYVPKHDPSAGS
SCRLHIAGADATIETRSATEYFLEFFGTFFSASGSLRTKNNRNGSCNTPQWTAEQIDAIQ
PIISERACLEQEHLLIAVKSADSEEGELVLSAFITGAVGESQANSVMKVGDVDDESYSRT
STLSSTRRQTYRTPEELNAMRLKRSSRVLTGRHRSSASDYEQPDNLGLEEDGSNSPPPPL
PPRRGSDNTTLSPPTAAPPPRRPSRSAASQPLTITSAMTTVEATVAAVSGAESGAPPPPV
PRKSERVMSMVGSDALAIDTSAAALHMEPKPETPSALFDQIGHPELAPLFVQAGYDDLEF
FGDITEDELEEIGVGDQQLRQLLMQTFKHATSCSDA
Download sequence
Identical sequences PTSG_07791T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]