SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07982T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07982T0
Domain Number 1 Region: 516-610
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000175
Family C-type lectin domain 0.043
Further Details:      
 
Weak hits

Sequence:  PTSG_07982T0
Domain Number - Region: 413-442,475-548
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0103
Family Phase 1 flagellin 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07982T0
Sequence length 673
Comment | PTSG_07982 | Salpingoeca rosetta predicted protein (674 aa)
Sequence
MGKTRVHPQAHKRARQHHGLVMAATAIAVILALVPASTAQPPCLTIQEAGFETPALSAGE
IRAFSSSVWDTDSSFNLRQPSPIAASQGVFAIDASSAALFQVLNDTFQPYREYELTVDTL
RFSGTVYEDISGFYLTLGSVANPFAAGVNVVSTASLAEDVVETHSVTVRVTGDSALVGDQ
IRVGVALYGSGNSPLFDNFELCIIEQTSTSTSTSTSTSTSTSTSTSTSTSTSTSTTTSTS
TSTSTSTSTSTSSTTSTSTSTSTSTTTSTSTSTSTSTSTSTSSSTETEAFIDEGLDNFES
PVIADGAFVALDGNSDWTTTSQALFIVAAPNTLLPDPYPSGQRQGVVCLHSASTGRSCYM
RLPLINNSTGEAFTFRPLVTFRFRAYVLRNLDVTYPMTNTITISLQRADTHAVVASATID
PTEFDGNSTETMLEVEHEVMFSSPEKHVGIELEMAFNGTGPSLAVDEVDFARIAFWERDT
TTFTTTTTTTTTTTTTTTTTTTTTTTSTTTTTTTTTMMTTTFTTTTTTTTTTTTTTTTTT
TTSTFEGMCTGLPESDGFILFENYGYAVISSVKVARDDAEVLCEDLGATLAAVRSPRENA
FLACLFNTYARVSSVHVHIFDHFDLNELVHIDFHFHLNFNNHIDVIFHVDIHFIFDLHIH
IHLNLDQHKHLNN
Download sequence
Identical sequences PTSG_07982T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]