SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08395T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08395T0
Domain Number 1 Region: 136-282
Classification Level Classification E-value
Superfamily vWA-like 3.41e-27
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 2 Region: 901-1063
Classification Level Classification E-value
Superfamily vWA-like 1.48e-22
Family Integrin A (or I) domain 0.0042
Further Details:      
 
Domain Number 3 Region: 626-783
Classification Level Classification E-value
Superfamily vWA-like 2.37e-22
Family Integrin A (or I) domain 0.0035
Further Details:      
 
Domain Number 4 Region: 381-537
Classification Level Classification E-value
Superfamily vWA-like 1.93e-17
Family Integrin A (or I) domain 0.022
Further Details:      
 
Domain Number 5 Region: 1690-1769
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000129
Family Dystroglycan, N-terminal domain 0.035
Further Details:      
 
Domain Number 6 Region: 4-74
Classification Level Classification E-value
Superfamily vWA-like 0.00000608
Family Integrin A (or I) domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08395T0
Sequence length 2418
Comment | PTSG_08395 | Salpingoeca rosetta predicted protein (2419 aa)
Sequence
MPAAGHRLNSQSVVITITDGGSTQPDQEIQDEATRLENTGALLVAVGVGASTDDELTELG
ILSQSPNSIFDLDAAEEAYNNGSDTFNQQVLQPVFNPPPTTTTTTTTTTTTTTTTTTTTV
VTTTLPLEPLNASMFHPLDAIFILDGSGSVTQPNWDRQVDFLTSVVSLIPVSLDDIRVGV
CVLLGNAQTLIDLNGATSPGAVVAAVNAYTYENFNPSATGEALNQVHTSMLLQANGRRTD
VPAVVVVITDGDSQETDEYVQEQADIVRSGVDRMYSIGLDTTDPEHAAEQLVVAGSASRV
YELSTLEGQLASDQPAFEESFIGPVFMGTAQPEASSSSAVPLPSSSSPAPLPSSSRASSA
ALSTSAMLSSTVVPTSSMPAASTPQPTPTPSPQLCAFLPTDMVLVLDASGSVGQSQFDDQ
IQAAIGLLEGLPLGGSIRVAGTEIKSSPEVVLTYDQGSSYDTAAATLQSIAYGGNQGSAV
VGALNLAASTFGSAARNLFVVFTDGDPADGFDELLALVSDIRSTGDLVQVIGLSGPGGTF
NTTALALLSDASTPYTTLPALLQQQQDGTAFGSFVRPLLCMLPSTSSPPSSTLLPSSSIP
LILSSTVQPSASSLVTITPSSSLALPTPSPTPTPTPTPPYCDFLDLDVAVVIDGSGSVPR
ARFDELKAFASQFVSELPLGVAGSTTRVGVSLLKGTPSTVAPLSSDTDAILAAIANEPYV
SNRPSAAASALAYVTDTLFGAAYQGRGLVVVLSDGDSQESLEQVRAEAERLAAIGARTVV
VAFPPPGEVALDTASLSFFVQSLARDVFALEDLLALPLPAYRDAFLLPTVCNVTLPVSST
SSVAVLSSTPSPTPSPRPSSITIVPSFTPTTSVVAPSTTVLVSSTVQPSAFTSVASSTAT
PTVTPTASPTPSPEPPFCAFDGEDVVFIIDGSGSVPRITFNRSIDIVAAAVTTYARSNIR
VGVVLLKGTPEMVVPFTPSSDTDTVLAALRSLVYVPRRPSATASTLRYVREAMLTAGNGY
RGGALRVVVVSDGDSQENPSDVREQARLLRSIGPPSVLQAIAFPPPSTPGQLDTDALLDI
VQRTANIFSFETAAQLLNMDLTLFQLNFFEPIFCDFPLLPSPSVSSSTVLPTPSSSPAIS
VIASSSSPVLTPSPTPTPVASSPAVSSTPALSSTPAVSSTPAVSSTPTPVASSPAVSSTP
VLSSTPAVSRVVTSSTVLATPTPSSSLVVSSSTVTPTPTPTSSSVAVSTPVASSSFSSLV
ATPTPSSSSSSFVLVSTASPSPSLFTPSPSVSVSASVSEVVSSTPALSPSQSSSVSVTVS
PTPSVVSSLVVSTPSPTPSAIVSSSPVFSSTVLPSSSLVTPSPSVSPIASSSTVVPTPSP
SPSAIVSSTVSATPSISSSVAPSFISTVVPTPTTSVVQPSSSTAVPSPSIFTPSPSATAV
SSTLVATPSPSPVSSTLLFTPSPSVSLFSPTPSVAVSSSIATPSPSVSPISPTVTSSVVL
TPSPSPSISTPVVSSVLVTPSPSPSVVVQPTPTASPSLFTSSVAASSTVTASASPSPVVS
SSPSPSPISTSASTSVVAPSPTTAAPSLVSTSTVAASPSPSLVASPSVSVSTTSPVATST
SVVTSSVSSSASVVASPSPSVSPSPTSTPAASTTPTTPAPSPTPTPVPVDQPPLILNELP
RNLAATPGRGLFEFTVPEDTFWDAEDGFILTYVLVPLTSTWTNWLQYDTVTRMFSGVPTN
ADVGAYGFLLQARDSAGQYSPPLFFTIGVPRDVRLMPDLVVTLVLEESTQPQVSGRRRRR
QADVDVSDASGASAVAVTGAGAVEEGAAHVHRVGRATACPAGSLTLDPQEREDLITALAQ
FFAVEASAINLVSITPVPETCRVAVAISDNTASDCRAVERREQEINSDEFRLRAVVNAVS
PTLTVVDVQVDAEPCPAVGLPTATAAAEEVLTKTVVPAIVAAAVLIMLGILAMYAASPPS
SQGEARRQQGDLAHNEFSRRGPTTLISPPWLYDKGPEDEDKELLHGPDSPTYKEFLAQSM
QPPPYRGPREGGESETYMSGAAAPQYRPPPAYPYEAGRAFDFSASAGTDESVAGMEAYTG
EGVTTITTTTTTTTRFGMFKPAPPYIDPPDYASALHMEPTDGSYPFVFINRDTMYDVPVQ
PERVHDVRLPTTRTGTTGSSTSASSAGPSASSSAASSHRRQSRSEAGPQFDSGNTTSLLD
ETATYVATPTSASPQRQRAGGRRSDAGEFGDVSYAQAQPRASEPTYNMAAARQSAGSVDA
RQQQQQQQQQQQHEPMYDRSRPSTGTVPSSSLREHTYDRGVGGSSRRRRAEFDTLDTFVD
DDDDDDGDDDDEEGDFGDEQGVYTFSEMGDEDEAQADDGTYAAPRPTGTSETYATPVRQQ
EEQHIYASADNPDGSPPQ
Download sequence
Identical sequences PTSG_08395T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]