SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08419T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08419T0
Domain Number 1 Region: 224-458
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-33
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 8-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000198
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08419T0
Sequence length 732
Comment | PTSG_08419 | Salpingoeca rosetta hypothetical protein (733 aa)
Sequence
MLGYEVVGWSSYSAQFHPKNIKEDRPYDQSSRWSADISSAPQYVLLKLHSPALVKAVIFG
KHEKDNNCNVRELKVLAGMQADKLDVIMHTGLQNDSRPETIPVDSVTLCQYIMVRPLRVW
EVDFHISIWYIGLLGTEKPTAIKRHHKRVQQEATRLCLKHLRRSGYMDCFEQLLKKSKVQ
LEDTSVSALYSLLVQKGDFAAVEEMLTQLDTDKNIFNEYIESQPYQYEWKQLEPLNSFGL
KAEADEKPSMRGGHQVVIDTTSRVMYLFGGWNGADELGDLWRYWIDENRWQCISDDALAD
GGPCARSCHRMCIDKDKKIYVLGRFAQHAHPQDFRVYDTVCDTWRTISRDTAGDGGPPLI
FDHQLVYWRNKHAILAHGGKLCGRDQMYGGMYMFDIATSKWEKLFDANESAPISPRMAHS
MFISEAESCVYIFGGQYDGHYRADLHRYDLIRRRATLLDADCTIKSHITVSFSQRVVFDA
DKREMRFLAGVEQHGEPRYLCDNVLYVCKLDTLAWEQVNFSQDQSDDVPCRRFGHQFVWD
PVSKCHFLSAGNPGLVDSNRLRLSDLWSLRITRPARHDVLRKCVKLVRLHRYQELAGTDQ
LRAYRYLCGPLREAFAGEVMTHAALAKELFRAQSSTTTATATPATATGKDTAFERRTATF
QYIMQYLPKSMREPDADLMDIVRLPPTAGRLGGAMSSGRTCSIDDDDDDDDDGDDDDDAC
DTTPDELHPRQS
Download sequence
Identical sequences PTSG_08419T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]