SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08979T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08979T0
Domain Number 1 Region: 83-262
Classification Level Classification E-value
Superfamily NHL repeat 0.00000191
Family NHL repeat 0.027
Further Details:      
 
Weak hits

Sequence:  PTSG_08979T0
Domain Number - Region: 230-385
Classification Level Classification E-value
Superfamily NHL repeat 0.0243
Family NHL repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08979T0
Sequence length 387
Comment | PTSG_08979 | Salpingoeca rosetta conserved hypothetical protein (388 aa)
Sequence
MPSMRNSVLGEVVLEEDDAGAFHINTTDPMSQPVFLNGVNVHEMLSTLMSTVSEQQSAID
RVFGSKVCTLSAQTFGQLGFTTNKWLGGVLATNGLIYAAPSKSPSVLIINPSTNTVDITT
IPGLGTDNGKWAGAVLAHNGLIYMFPSNRDTMLIVDPNTNTIDTSSIDSLGSGNSKWKSG
VAASNGLIFGIPSSATSVLIVDPETNTADITTLSGLLSQDYKWYDGVQAENGLIYCIPAM
ASAVLTINPESLTMDLTTISGLGTGFKWLGGVLSRSGLIYSIPAHSATTLVINPVTNTTN
ELPVVEVTNFPKWVGGVLAPNGNIIGIPYSSSAVIVVNPPTNITDTRIINDLAGSSFKWW
HGVLANDGLIYGIPYNADSVLVIDPGC
Download sequence
Identical sequences F2ULV2
PTSG_08979T0 XP_004989777.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]