SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09530T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09530T0
Domain Number 1 Region: 194-328,525-622
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.33e-33
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 127-220
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000102
Family Pseudo ankyrin repeat 0.05
Further Details:      
 
Weak hits

Sequence:  PTSG_09530T0
Domain Number - Region: 804-840
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0785
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_09530T0
Sequence length 977
Comment | PTSG_09530 | Salpingoeca rosetta predicted protein (978 aa)
Sequence
MEHGSREAGRPRAMAASASLRIHSNDDNHEDAVVVSVEPQESTPQPEATTASSTTMNSGG
GSTATSTGPRSCCHASNGQPPQMEGSSITTPATNDAAASTAPHRLQGLVQLDRSFVELEH
TSCTDTNPVNTLLRACREGNLAEVEQLLITHGCGLLQSATNEHTCPLAEAALSGKRIVCE
VVIAQDRDQLAWTNASNETVLFNAALGGSVDVFSLLVSEGSLNCTHRNTQGTSPIFFAAA
RGKLDIVRWICRHARGVLRHTNDQRESFASVACKKGRMNIVEWLVSKKVDLSNFHIASES
PFLVACRAGRHDVVTFLLERNVSLEPHRSAFTDEASNALAACAMGGHDDLVALFLEKHVF
TVQSYVEALNKAVTSNFPHIALQIFNAIDAGKIHHPFDFAGHTLGVLIRHGHPRHAARLL
QQHDKHERFAQGLVQFLIPAVRSGRLDMVKWVVSTDIARRETGAAAAVQMMRRLSIRGRP
AKYQSPSARELAAALAGCEHMPAIVHEGLKEARFHLVKWLTITLRLPASAFIWERGTALH
MAAAAGHTEAAFFFAEHMHLPADKPDVNGNRPLHLAARAGATAIVRLLLVSGADLAARNK
ADRQPLGMALLHDRDLTAHVLREAPSLTPVHVALAGHMHGLLADRLRRGVLNPETALNDP
AFGAAMPTFVQLARNMIRAPPLAMSNVNDRLEALLRSNNDNDDGGGGVDDGDGESGSSGS
EGDGDGGDYVHDIDADDDDDGDDDGSADALASETSSAIGGASGGGGDEAIVHHHVTSLFA
QPIPSIASASSSSSSSSSSSAHAPTPTTTPTTTPALTAASTASSLPQPSQQQQQQQQQQQ
RTLRRRRKKKKRAVPGPLADGTMVPTTITRTELLRGGGGGYDATVLPALDAPVSVTLLGA
SQGPLPRRVCVDVLRTLNMAINISRPWNPSNHRLFPTAYRHLVFKLLLCFMHERFSDVPQ
EHVFAIIKHMTRAAIQQ
Download sequence
Identical sequences F2UL96
PTSG_09530T0 XP_004989959.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]