SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09719T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09719T0
Domain Number 1 Region: 372-499
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000074
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.034
Further Details:      
 
Domain Number 2 Region: 221-283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 269-320
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000447
Family TNF receptor-like 0.0056
Further Details:      
 
Weak hits

Sequence:  PTSG_09719T0
Domain Number - Region: 83-188
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00124
Family Apolipoprotein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09719T0
Sequence length 502
Comment | PTSG_09719 | Salpingoeca rosetta predicted protein (503 aa)
Sequence
MLALAVLVACAFCVNAQNAAPEPEMRAVNGSLEIHVQQGNAVYAVEHSGSGESTRLDLLQ
LLRRVTPLEERQDKTDWRLNATVDAMTSAVERLRERGDDLGRRTNTSIAALEAELTSTIN
TKTQTLATAVGEDIHSLRANITATMSQLRASVDSELSDQRSAINDLSGQVTAITDQLVPR
MQALEMQLQALQPVLDTFAGCTNIAAYAKVDGTCYPTSGVCPDPVVMEGVTITIATSVQP
DVIEYVPGTLVNFACPDGYYLPGDDTATCLRTLEWSRDPPECKQLTVCRPSEYVKTPATS
STDRECEQCPPNTFSSTDNAATCASYSTCGVNKYASVAPSPTNDRGCTPCPSGQVQPSSS
YTGNTCYVYRKLPIASCSASSEYSSTYRCSNAFNGVFADGGNAWATSGQGTGSWIRFNFP
QNVRVTRMRYQQRSCSCEWYRQLRLDFNDGSSRTLDLPNSQGPINKDFTYTGAATSVKVT
GTQVYTTTNNGFNEVEFYGFIV
Download sequence
Identical sequences PTSG_09719T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]