SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09841T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09841T0
Domain Number 1 Region: 355-695
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 6.28e-41
Family Oxysterol-binding protein 0.0023
Further Details:      
 
Domain Number 2 Region: 84-200
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000268
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09841T0
Sequence length 837
Comment | PTSG_09841 | Salpingoeca rosetta predicted protein (838 aa)
Sequence
MSEHSTEYSNHGHDVDDHDDDLGDHHPHHQFHSHESASAFAGLFDRDSRKQRAIQERKYR
AKREKYEEEKQRMLHRTGYDLSLKTIKTGLLKVRNQLRSWVKFYCELRHGMLIMYKEDKH
DAWMDTILLSGGLVIERPSRKEGFTFKFSHPLKQSIHAPRGPRGELWINLLRMPSDHCIF
RVATAEECDEWIAAFKHAIYGAHPAYDELMTGAITTGLVDDDDDLVARSPLSRLGTSGPA
GARGRAGSGGDLAPSLEQPSALSLSLQKRLRAAGTQQAENEDKDQDDADDVVPQPRSSPP
AEYSPPAPPVAVDETEWVPTAPLISDDDTAPAQVLSDETRNRLWAIAAKLDVGASLPVPI
ELRQPQSELQRLSDLFLHADFITDAAKHKLPRCRVVCVLRWAVSALCNRPAGMAVPLPAA
PGEVFRCHFECPQHSATPPTRAFFVAELVDSSNHTVAFELTNRQAGWRVLGSLAPTTKFF
GNTITHEYHGTISVRLDHFGETYSVQLPKRVTRGVINGRTSTCLQGALKVACAATGLSCT
MHVDTHVRGSVTGRVTDAETDGLTISGSWSGGIHIARGETQQLLLACTSAELRARRLSKR
VVAPSHLWTQASTDVDVTDSQVLWAAVQRALLQSSIGAAQAAYDRIIRTAAQQSNDRYYS
KFFAPQSDGWLCTTTIDRAWDYGQDVYEYQQQGELKVLTVDDAGLQISGDTASPPTLRRR
HASVHTDTDSHAAVDVAAYTRARAPTYATSPMSKAVTPVTPGDLTAAAASLPSNTWEREV
QALEQRMLTVERMLARERLTLLTCILLFLLVLLVRCWHCTPLAVMAFCCDVGGGGDG
Download sequence
Identical sequences PTSG_09841T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]