SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09853T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09853T0
Domain Number 1 Region: 365-454
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000143
Family Phosphotyrosine-binding domain (PTB) 0.005
Further Details:      
 
Weak hits

Sequence:  PTSG_09853T0
Domain Number - Region: 160-250
Classification Level Classification E-value
Superfamily Ferritin-like 0.0588
Family Ferritin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09853T0
Sequence length 459
Comment | PTSG_09853 | Salpingoeca rosetta hypothetical protein (460 aa)
Sequence
MATTMKSGRGMVGTDGSGKEGASRSSAQLLMENEQLYRTLARERGERVRTSTSSDDHVHR
QVERLQQECRSLRIQLDEEKEENRILQNERDRLQREKNALASGRDGQSVDAGSDQDSQYY
SEEIERLRSECKQTQLRLKECQLNLESSELVLEGYRKEVHALTVEREALENLVEMLRREQ
GDPSSSSSAHVRGGVDMDTHQRALEELMALEKDAVQAQKQHQAAQEEIRFMAEQMTREQG
QRAREMEDMHMQLHDSKSAYDALLSRYASLERAYQALQVQLEEAYRMQRNAQAQAIYATT
NATTNATTTGAARREDTLRSAAPPSASSSVPGYSASLRRIRVDALENWGDGYHAMPTGGP
KNAYYFPVNVQESMLSQEHALLGPAWLRIAPTSVALLAQQSWDLIMECPLSCVRKFGKDE
GVLSFELGRHAPTGQGVLYLATIHMTDIFDVLGRLTGSR
Download sequence
Identical sequences F2UNC1
PTSG_09853T0 XP_004989211.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]