SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10281T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_10281T0
Domain Number 1 Region: 166-365
Classification Level Classification E-value
Superfamily vWA-like 2.09e-52
Family Integrin A (or I) domain 0.00073
Further Details:      
 
Domain Number 2 Region: 27-171
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.00000000126
Family Hedgehog (development protein), N-terminal signaling domain 0.011
Further Details:      
 
Domain Number 3 Region: 568-733
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000143
Family C-type lectin domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_10281T0
Sequence length 736
Comment | PTSG_10281 | Salpingoeca rosetta hypothetical protein (737 aa)
Sequence
MVATVPGALVLAGAALLLHIGQGAHGLAPGESHPSDTTEAEVCGVAVDYIDTGTAQYNDL
VVYETSGNVAFQDETFKRMTDYMAQLLLSLDVVSTETIVVVDGFTPRPEVAVRAPNLLDV
GRALRLRYQADGSAATASRLATLAQACVDAGFDFVSVPNDIGSDNYVHVSVPKMTCGNAA
ADLLFILDGSGSVGSSNFQTMLSFTRTVATFFDVSADTTRIAVMVYASYNYLIFDFNYIL
THTKDELLDAISAINYPYGGTRTGGALDYARTVMFTADRGVRPSSEGIPRVAMVITDGAS
ADDVAAPAQQLRDEGVTLYAIGIAGANENELNEIASPPITSNVVFISTFSEFGTLAAAIS
RANCDRAATVSATQDIMVNETAPGEIRYFQPNLQDLTDDVLIYIEQLSGDTDLYVSGNDS
PGPFNNDASVEGDAPVKAVLVNNTDSSDLVYIGVRSRSDNPNDTVSYRVVVTNSLFVGDA
TYTVSLSARDNVVGKGVFRMPALRDFGLGLERHDFDYTLGGPDSEYFYLTNSGVDILLQR
ELQFGVAYSVIVRGTLEDPVQLTGSVIVTFIFDSTTTTTTTTTTTTTTTTTTTVFAGYRY
EAVADSPATWFEATSACASRGGFLAIVQSHVVSDHVAKLARNATRAVGGSEDTELHTQAW
IETYLPASLAGDGGVANPSETLAFGPWTPTTARSECRFNCPALMFRSRQSRAMAVPKDIQ
CELKRPFICQIPVYLH
Download sequence
Identical sequences F2UQV0
XP_004988330.1.12839 PTSG_10281T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]