SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_10655T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_10655T0
Domain Number - Region: 8-23,169-198
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000586
Family Di-heme elbow motif 0.074
Further Details:      
 
Domain Number - Region: 296-340
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00341
Family TNF receptor-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_10655T0
Sequence length 452
Comment | PTSG_10655 | Salpingoeca rosetta predicted protein (453 aa)
Sequence
MAGMSSANGCAECHSTRVPSATPPDATDCLLCDSNLTSCALPIALSAGYYAKDHRCVPCH
TWCMGTWASAPCSASYDAPLPDRASCFPTSVCEEPFIETIPPPLTTDRLCSCDTLTCNKL
ITQLFEEMVCAEPTDEQLDVVLDVCCSGQGEDGIRNTRQMDAYEARRSCPGCTDTCECSA
GFMLVYDADSADCRPCDGVTEFSASIGGSKCEAIEECERGQEEISAPTHYSSDRVRRDCP
AGAIDTDSDGSTGCQMCPAGLYTEAGSHGSCSSFTCRAGTHHDHHDSDPATLGMPCLPVT
TCDAGEEETAEPTIPTSDRVCSQCELGATFKRVDGQAESCRPVTQCGPDEKAIRFASPRT
QHDSLCRKCVQDTCVPVSRCAASEYISFGTFQSQVPTLECSECPSGRFEIRACSALEDVQ
CAGCSACPPNTYILRACDSENDVLPAVQHMLR
Download sequence
Identical sequences PTSG_10655T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]