SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479166923|ref|YP_007795422.1| from Coprococcus sp. ART55/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479166923|ref|YP_007795422.1|
Domain Number 1 Region: 18-267
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.13e-66
Family PdxS-like 0.0000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479166923|ref|YP_007795422.1|
Sequence length 292
Comment pyridoxal phosphate synthase yaaD subunit [Coprococcus sp. ART55/1]
Sequence
METTERYKLNKELAQMLKGGVIMDVTTPEQAKIAEAAGACAVMALERIPADIRAAGGVSR
MSDPQMIKGIQNAVSIPVMAKCRIGHFAEAQILQAIEIDYIDESEVLSPADDVYHIDKRQ
FKVPFVCGAKDLGEALRRINEGASMIRTKGEPGTGDIVQAVRHMRKMNSQIAEIVSMRTD
ELYEAAKKLEVPYDLVQYVHENHRLPVVNFAAGGVATPADAALMMQLGAEGVFVGSGIFK
SGDPAKRAAAIVQATTNYNDADLVAKLSEGLGEAMVGINEQEIAILMAERGK
Download sequence
Identical sequences A0A173WG74 A0A1Q6MGW6 A8SYI9 D5HH36 R5WJZ9 R6KXB6
WP_004848658.1.58741 WP_004848658.1.63492 WP_004848658.1.80485 WP_004848658.1.90043 gi|479166923|ref|YP_007795422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]