SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384893122|ref|YP_005767215.1| from Helicobacter pylori Cuz20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384893122|ref|YP_005767215.1|
Domain Number 1 Region: 12-101,133-250
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000108
Family PHP domain 0.014
Further Details:      
 
Domain Number 2 Region: 294-446,567-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000624
Family ABC transporter ATPase domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384893122|ref|YP_005767215.1|
Sequence length 673
Comment ATPase [Helicobacter pylori Cuz20]
Sequence
MGNKDKNKGSSWHKWDLHVHTPYTHLNKAYQCSEEDFIQKLCTSEIDCIGLTNYFKFNEK
EFALKEKIEKRGIKVFYNLEVRLDYQNKEDDCLDFHIIFSDEVSSDGIKKFLLNVKANVC
GIEKKLADLEKDDFDKAVVNFDQLLECLEEESLNLMGKYLLGFLSRGHGNSRSSSNYEKI
AKKSHFLIHSSDDQGNLKEDREFWLKENKPLLQSSDAHKEDSIGKKYTWIKAEKIFEGLK
QIIYEPETRVSVDKEKPQDPLHKIDCVGLHFDEDVKNTNEKGDTPFCYAGFNETLFFSPN
FTCVIGGRGSGKSTLLQLIASAIKNNSFVKDLVKDLKHETIQKCIEIQPDTVDSVEYLAQ
NEVEEFATNVSKFTEAIFNRIDSKSSGKLKELEKQITKGIEKFDEQIAYWQKKTKLEEQL
KESEKIRKKYQSIIDTYADKDYLDKKEKLQENRKVLIDLKQSKEGFLTFIKELKQVVNFE
SKENMEEKNSYDKVYNQLKQNICKELEEIDTDIKNGRFDSDDKNIKKLESECQTLFQEIE
EFLKEKGVSDENIGDVGNANYRLANIKMNINDLKREIEEIANKIKGFSYEDIDKDIEKFK
NQINEELSKINSAFEEISKNHKEVKPITIEYRLNEDIFEEVFEDFDKLVDKGFNTKKHQS
KIKEYLKEIEKTL
Download sequence
Identical sequences gi|384893122|ref|YP_005767215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]