SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01004198G0010 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01004198G0010
Domain Number 1 Region: 143-263
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.16e-30
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01004198G0010
Sequence length 290
Comment PH_genemodel_v1 PH01004198..4658..9302 . - . ID=PH01004198G0010;Name=KH domain containing protein, putative, expressed
Sequence
MDERIPPHPFFQYSLSGVHSSPHHHNPMRSSASERERYLAELLAERQKLAPFVQVLPFCN
RLLNQEILRASSLPPNPNFAEPERIDHGNPLRLAGHPMNGQPMDLEGWSGMQTEHMGVFQ
SSSMGWNGAPGVAGGPVVKKVVRIDVPVDKYPNCNFVGRLLGPRGNSLKRVEATTQCRVY
IRGRGSVKDSVKEDKLRDKPGYEHLNDPLHVLVEAEFPVDIVDARLNQAVAILEDLLKPV
DESMDYYKKQQLRELAILNGTLREGSPSSHLSPSVSPFNSTGMKRAKTGR
Download sequence
Identical sequences PH01004198G0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]