SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01000178G1080 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000178G1080
Domain Number 1 Region: 174-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000113
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 265-296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000183
Family CCCH zinc finger 0.0019
Further Details:      
 
Domain Number 3 Region: 100-132
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000484
Family CCCH zinc finger 0.0027
Further Details:      
 
Domain Number 4 Region: 39-66
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000576
Family CCCH zinc finger 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PH01000178G1080
Sequence length 300
Comment PH_genemodel_v1 PH01000178..762674..766910 . - . ID=PH01000178G1080;Name=zinc finger C-x8-C-x5-C-x3-H type family protein, expressed
Sequence
MDAGRKRAAPEGANGAGAGAGGGAKRARESESFQMGVGSKSKPCTKFFSTAGCPFGASCH
FLHNFPGGYQAVAKMTNLGGPAPPARMPMGPSVTDGPPTPAVKTRMCNKYNTAEGCKWGN
KCHFAHGEREFGKPMPLNNSMAPSMGPRPNGYFEPLPMPGSDMVPPSTFGASATAKISVD
ASLAGAIIGKGGANTKHISRMTGAKLAIRDNEADPNLKNIELEGTFDQIKHASTMVKELI
VRISGNAPPAKNPARGSHARGPGSNFKTKLCENFNKGSCTFGDRCHFAHAESELRKPAAA
Download sequence
Identical sequences PH01000178G1080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]