SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01000397G0590 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000397G0590
Domain Number 1 Region: 1084-1462
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.58e-111
Family Oxysterol-binding protein 0.00095
Further Details:      
 
Domain Number 2 Region: 485-851
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.23e-109
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 3 Region: 46-78,110-166
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000186
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  PH01000397G0590
Domain Number - Region: 855-895
Classification Level Classification E-value
Superfamily PH domain-like 0.00246
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000397G0590
Sequence length 1477
Comment PH_genemodel_v1 PH01000397..356543..378639 . + . ID=PH01000397G0590;Name=oxysterol-binding protein, putative, expressed
Sequence
MRAREMHPLCCLAADCPGRGLAAGDSSPPPPLLRADDASGAEEAPPAVAGVLYKWTNIGK
GWRPRWFAIRGGVLAYSKIRRRVAASLPRPPPEAAGAGVRLIGGVARGGGGGGERPIGFV
HLKISSFSESKSDDKRFYIITSTKTLQLRTGCAKDRVAWIEALVSARSEYSFNGGLPCDQ
NDGSFSTEKLRNRLHSEGVGEVIIKDCEQIVHSEFSQYHTQMKQRCDDYLSFIGSLRREL
ETQLPPSPPTPVRFPLGRLYSSSHGPAAGGSAATMEAAGSTGSTSSSPPTTFFYHPTVER
WATMDGGFGDRICVVTTGTSGPPKSSSPPADERLVPSWQPRRRRPDPASPSPSVARSGVP
SCPHLQYMPEVVNSGDATITEKSQSQLFKAECSSSGKCSEYSNTESSDDAGKQEIGQLSD
EDEFHFYDTRQSFSESTASPDLKMRCLNYGNEAYKFGELLAVDKANEYLLSSSERRSKLP
EPVEKEKGVSLWSMIKDNVGKDLTRVCLPVYFNEPLSSLQKCFEELEYSYLLDRAYECGL
RGNGLMRILYVAAFAVSGYASTDDRPCKPFNPLLGETYEADYPEKGVRFFSEKVSHHPMV
MACHCEGKGWKFWGDSNLKSKFWGQSIQLDPSGMLTLEFDDGETFQWSKVTTTINNLIIG
RVYCHHHGTMKISGNRQYSCKLMFKEQSFLERNPRQVQGFVTDADGTKVASLMGKWDESM
YCTVSDDAFKVNSHGSRQIAGATLLWEKNKPSANPTRYNLSSFAITLNELTPGLKEKLPP
TDSRLRPDQLHLENGEYEKANSEKLRLETRQRMARKMQERGWKPRWFQRDTEDGTFRYVG
GYWEAREQRKWISSFSESKSDDKRFYIITPTKTLQLRTGCAKDRVAWIEALVSARSEYSL
NGGLTCDQNDGSFSTEKLRNRLHAEGVCEAIIKDCEQIVHSEFSQYHTQMKQRCEDYLSF
IGSLPRELEVVNSGDATITEKSQSQLFKPDCSSSGKCSEYSNTESSDDAGKQEIGQLSDE
DGFHFYDTRLSFSESAASPDSKMRCSNYGNEAYKSGDLLAVDKSKEYLLPSSKRRSKLPE
PVEKEKGVSLWSVIKDNVGKDLTRVCLPVYFNEPLSSLQKCFEELEHSYLLDRAYECGLR
GNGLMRILYVAAFAVSGYASTDGRPCKPFNPLLGETYEADYPEKGVRFFSEKVSHHPMVM
ACHCEGKGWKFWGDSNLKSKFWGQSIQLDPSGVLTLEFDDGETFQWSKVMSTINNLIIGR
VYCHHHGTMNISGNKQHSCKLMFKEQSFLERNPRQVQGFVTDADGTKVASLMGKWDESMY
YTVSDDASKVNSHGSRQSAGATLLWEKNEPSANPTRYNLSSFAITLNELTPGLEEKLPPT
DSRLRPDQRHLENGEYEKAHAEKLRLETRQRMARKMQESGWKPRWFQRDTQDGTFRYVGG
YWEAREQRKWVGCNDIFGNFSDNPNQKAPTLCTSAII
Download sequence
Identical sequences PH01000397G0590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]