SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PH01000428G0370 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000428G0370
Domain Number 1 Region: 4-53
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000000102
Family SAP domain 0.0056
Further Details:      
 
Domain Number 2 Region: 109-173
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000465
Family PHD domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01000428G0370
Sequence length 890
Comment PH_genemodel_v1 PH01000428..241105..253460 . - . ID=PH01000428G0370;Name=ATSIZ1/SIZ1, putative, expressed
Sequence
MADLASTCKDKLAYFRIKELKDILNQLGLPKQGKKQDLIDRVLALLSDEQGQRHHGWGRK
NSFTKEAVAKIVDDTYRKMQIQSAPDLATRSHSGSDFNHFRPKEEANDPFQAETKVRCLC
GTTMLNDNVIKCEDDRCQVWQHMSCVLIPDKPTDGVSPEVPPHFYCGLCRLSRADPFWVT
TGNPLLPVKFMSSGVANDGVPLGVCLGRLGARRGLPPRRPSRFIPPRRRLGARRWSAARL
ASRGTLVTLKAHQTSVPQTVEKNFQLSRADRETVQRPEFDLQVWCMLLNDKVQFRMQWPQ
YADLQVNGILVRVVTRPGSQLLGINGRDDGPLITACSREGTNKICLSRVDTRTFCFGVRI
VRRRPVAQVLSLVPKEAEGESFEDALARVRRCLGGGDTTENADSDSDLEVVAESVTVNLR
CPNSGSRMRIAGRFKPCIHMGCFDLETFVELNQRSRKWQCPICLKNYSLENLMIDPYFNR
IASLLRNCNEDVNEIDVKPDGSWRVKGDAATRELSQWHMPDGTLCNSKEDTKPGGENGNE
LKIEGTSDGHRSLKIGIKRNPNGTWEVSSKADDKKPSVVGNHIQNNIGFRAPNIVPMSSS
PTGSYRDGEDTSVNQEGSMHFDLSLNNGHEFDSFPLNFGQTYNTQDRSQQQHNATGVIVL
SDSDEENDAIVCPPTVYDNTTANGSFPFTTNGAGFTERYQEDAGVGTSGLGLLSNNADDF
EMNNWQMHPYPQSEQGFQFFGNDTDAANTFVGSHNSFSIAPNDYSLDCNVGVEEAHDLPV
CRNSNEMHGSLVDNPLALVGDDPSLQIFLPSQPSSVPLQEELSVSANAPNGVQSDDWISL
TLAAGGGGNEESAPADGLNSHPQIPSKETGVEPFIDAGLSPFYDFISFLL
Download sequence
Identical sequences PH01000428G0370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]