SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01000915G0190 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01000915G0190
Domain Number 1 Region: 358-678
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.92e-69
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 45-303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.5e-61
Family Legume lectins 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PH01000915G0190
Sequence length 741
Comment PH_genemodel_v1 PH01000915..101960..107056 . - . ID=PH01000915G0190;Name=lectin-like protein kinase, putative, expressed
Sequence
MATRVLVLFLLLLATSATSTSTSLATNTTDGSRAPAAPGGADNATTSFSFSGFHAEFRGV
NVTVLGDASINQGALQITPDSHNDASHYLTNKSGRVLYSNPFRLWHHDNGNGNGNATGGK
KVASFSTVFTVNVFRPGGTKPAEGLAFVIVPNADGPPNGSYGGFLGLTNAATDGDATNQI
VAVELDTEKQPYDPDDNHIGLNVNSVVSVANISLKPLGIEISPVKTVNYTVWVDYDGAAR
RIAVYMAVAGEEKPLSQVLAAPLDLGATVAERSYFGFSASTGSKYQLNCVLEWNMTVEKL
PSDDEPGKRLTLGLAIGVPVGVFALVAAVALGYLYVVKRRNVHGDDGGAITGTMIRNLAG
GPREFDYRELRKATNNFDEKMKLGQGGYGVVYRGVVDGDHTSPGGTGSAVEVAVKKFSRA
STQGQNDFIAELSIINRLRHKHLVRLVELSSNKVVIEYGDCVRLEWWSHNNGELLLVYEF
MPNGSLDQYLFSSAPGRQLLGWELRYNIVKGVASALHYLHDEYDQRVVHRDLKASNIMLD
AAFSARLGDFGLARAIETDKTSYMEEVGGGVHGTVGYIAPECFHTEKATCESDVYAFGAV
ILEVVCGRRPRCDIDGFHFLVDWVWRLHRDGRVLEAVDPRLEGAFDEDDAERLLMLGLAC
SHPTPAERPKTLAILQILLRSMAPPVVPPFKPSFVWPATDGGFDMMTTTAGTTSSQVSTI
MTSMSTWSGDESLAEMAHFEA
Download sequence
Identical sequences PH01000915G0190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]