SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PH01001947G0150 from Phyllostachys heterocyclavar. pubescens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PH01001947G0150
Domain Number 1 Region: 183-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-56
Family Calnexin/calreticulin 0.00011
Further Details:      
 
Domain Number 2 Region: 355-470
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.92e-37
Family P-domain of calnexin/calreticulin 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PH01001947G0150
Sequence length 540
Comment PH_genemodel_v1 PH01001947..94369..102192 . + . ID=PH01001947G0150;Name=calreticulin precursor protein, putative, expressed
Sequence
MPKQIHEIKDFLLTARRKDARSVRIKRSKDAVKFKVRCSKYLYTLCVYDTEKANKLKQSL
PPVDKFSHAIACVHDKCLWGCGALLADAVVKLTWKMPRGKHVNLVMWRYVTGPRGSSDRP
PRCDSLRLRGPRGWPGRGLCRAHPLAEEIMVHHGLLRVHVFVRVAVCLAGPPRKTWLPFT
HRYGWGSRWVKSDWKRSEGKAGTFKHTAGSYSGDPDDKGIQTTLDARHFAISAKFPEFSN
KNRTLVVQYSIKLEQDIECGGAYIKLMSGYVNQKKFGGDTPYSFMFGPDLCGDQTKKLHL
ILSYQGQNYPIKKDLKCETDKLTHFYTFILRPDASYSLLVDNREREFGSMYTDWDILPPR
KIKEVNAKKPKNWDDREYIEDPDEVKPEGYDSIPKEIPDPKDKKPESWDDDDDGVWKPRM
IPNPEYNGPWKRKKIKNPNYKGKWKTPWIDNPEFEDDPDLYVLKPLQYVGIEVWQVKAGS
VFDNILICDDPEYARMVVDETWGANKEAEKEAFEGAEKRRKAREDERYRRDYMDDYHDEL
Download sequence
Identical sequences PH01001947G0150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]